2FIY


Conserved Protein Domain Family
FdhE

?
TIGR01562: FdhE 
Click on image for an interactive view with Cn3D
formate dehydrogenase accessory protein FdhE
This model describes an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulfur clusters and cytochrome b556, it is likely to have something to do with the insertion of cofactors. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Statistics
?
PSSM-Id: 130625
View PSSM: TIGR01562
Aligned: 4 rows
Threshold Bit Score: 466.334
Threshold Setting Gi: 90109452
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FIY_A         2 SRTILQPGQIEAAAN-----IPPHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDpER 76  Pseudomonas aer...
AAG08195       2 SRTILQPGQIEAAAN-----IPPHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDpER 76  Pseudomonas aer...
WP_010967003   2 SVSPVQPDPSVIGGVp---kAPFVLKPNLARLFNDRASRFEALAQGSHLAPYLNFLAGITRIQSELVSALPPPEPVPaDR 78  Sinorhizobium m...
P13024         2 SIRIIPQDELGSSEKrtadmIPPLLFPRLKNLYNRRAERLRELAENNPLGDYLRFAALIAHAQEVVLYDHPLEMDLT-AR 80  Escherichia col...
2FIY_A        77 LRKSREHGMPPLAYDLLVREGAWLPWLDALLAGYPAPAN-AAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPF 155 Pseudomonas aer...
AAG08195      77 LRKSREHGMPPLAYDLLVREGAWLPWLDALLAGYPAPAN-AAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPF 155 Pseudomonas aer...
WP_010967003  79 VERARANAMPPIDRAAMGGSPDCREVLQQFFEKAEALEKpAAAAEALAQVRTADEEMLTWMIGNVMADDLPVESLAHHLY 158 Sinorhizobium m...
P13024        81 IKEASAQGKPPLDIHVLPRDKHWQKLLMALIAELKPEMS-GPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPF 159 Escherichia col...
2FIY_A       156 LGAALQVAWSHWLLGLEEGAVVET-ESrtLCPACGSPPMAGMIRQGgKETGLRYLSCSLCACEWHYVRIKCSHCEESKHL 234 Pseudomonas aer...
AAG08195     156 LGAALQVAWSHWLLGLEEGAVVET-ESrtLCPACGSPPMAGMIRQGgKETGLRYLSCSLCACEWHYVRIKCSHCEESKHL 234 Pseudomonas aer...
WP_010967003 159 VAAAMQIQAARLAAGLDGSRLVPIrVG--VCPACGGRPVASMVIGFhGAEGARYASCSCCATMWNEVRVKCLACGSTKGI 236 Sinorhizobium m...
P13024       160 IWAALSLYWAQMANLIPGKARAEYgEQrqYCPVCGSMPVSSMVQIG-TTQGLRYLHCNLCETEWHVVRVKCSNCEQSGKL 238 Escherichia col...
2FIY_A       235 AYLSLEHdgqpaEKAVLRAETCPSCQGYLKQFYLEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAP 306 Pseudomonas aeruginosa ...
AAG08195     235 AYLSLEHdgqpaEKAVLRAETCPSCQGYLKQFYLEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAP 306 Pseudomonas aeruginosa ...
WP_010967003 237 GYQAVETg---dEEATVKAEVCDTCNSWMKILYQNKNPSLDVVADDVASLGLDLLMKDTEYKRAGFDPFLMG 305 Sinorhizobium meliloti
P13024       239 HYWSLDD-----EQAAIKAESCDDCDTYLKILYQEKDPKIEAVADDLASLVLDARMEQEGYARSSINPFLFP 305 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap