Conserved Protein Domain Family
gde_arch

?
TIGR01561: gde_arch 
glycogen debranching enzyme, archaeal type, putative
The seed for this model is composed of two uncharacterized archaeal proteins from Methanosarcina acetivorans and Sulfolobus solfataricus. Trusted cutoff is set so that essentially only archaeal members hit the model. The notable exceptions to archaeal membership are the Gram positive Clostridium perfringens which scores much better than some other archaea and the Cyanobacterium Nostoc sp. which scores just above the trusted cutoff. Noise cutoff is set to exclude the characterized eukaryotic glycogen debranching enzyme in S. cerevisiae. These cutoffs leave the prokaryotes Porphyromonas gingivalis and Deinococcus radiodurans below trusted but above noise. Multiple alignments including these last two species exhibit sequence divergence which may suggest a subtly different function for these prokaryotic proteins. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130624
View PSSM: TIGR01561
Aligned: 2 rows
Threshold Bit Score: 936.01
Threshold Setting Gi: 499225621
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM06006      21 EWVIGNGLGGYASSTVIGAGTRTYHGLLVAAPENFPGRLLLLSSLDEEISIDKEVYKLATHKYPDNISPEGFNYLSEFIR 100 Methanosarcina ...
WP_010923161  10 EWLLPTRTGGYASSTICGINARTYHGYLIVPLNQPHHRFLILSKFEDFLLINGDTYSMSTNYYPGSYYPDGYKYLIKVEK 89  Sulfolobus solf...
AAM06006     101 SPFP--LWVYQAGDFTLKKKVFMVHGSNTTYVLYDIISRKegalLKIFPLVSSRDFNLTARSGYLSFYQKAGPAGVELAS 178 Methanosarcina ...
WP_010923161  90 NSNSkiTWHYDFGYSQVEKTLRVHKGYNAITITYIATRGK----FKLCPFITFRSHHLAKKLQNEFFTYEIYPPNTIYIL 165 Sulfolobus solf...
AAM06006     179 SNG---FTFSLSSNLQYHPDPIWYFNLEYDTEKKRGLNFQEDIFNPGYFESKLEPGASRFFVAASTKDISSLTLEQVDKL 255 Methanosarcina ...
WP_010923161 166 YEGkriLNFEIHDKYELFNSGYWYYNFIYKLDQELGNNYIEDLYNPFCIVSTSNKISVTVYYDQRPKDLSVEENEHYDIL 245 Sulfolobus solf...
AAM06006     256 YVREANRqnllildskliesfalkllratDSFVVKnhATGENTVIAGYHWYSDWGRDSMISLPGLLLIPYRFEEARSALN 335 Methanosarcina ...
WP_010923161 246 KLLSAAG----------------------KDFVVK--GKDGWAIIAGYHWFDEWGRDTFISLEGLLLVDKQYDIAKEIIL 301 Sulfolobus solf...
AAM06006     336 NFARYCRRGLIPNTFPAFGGDPIYNTVDASLWFIHALDRYFAYTQDFLFLSDVWDTVSSIIDNYCAGTDFAIGMDSdYLI 415 Methanosarcina ...
WP_010923161 302 KYLNLEKRGMLPNNFISYNGEPVYRGVDISLWAINAIYKTYIYSRDKNFIRKVVDKVLDIIDWYSKGNGVIYNVDN-LIF 380 Sulfolobus solf...
AAM06006     416 WQGPQLTWMDAKVGEWAVTPRAGKACEVNALWYNALKTASYMGTLLGEDISSYETLAAGVASNFENTFWNPESncLFDLI 495 Methanosarcina ...
WP_010923161 381 HKGAPRTWMDASYDSRIVTPREGAAVEINALWYNALRVTEFLLNELGEKAEYLSEKAESVKKSFAEKFISQDG--LYDYI 458 Sulfolobus solf...
AAM06006     496 HQDEAGnqvkDPAIRPNQIFAVSLPYTMLSPE-KEKAIVDRVEKDLLTPFGLKTLSSDHPLYKGQYRGDALTRDtayhng 574 Methanosarcina ...
WP_010923161 459 NWDNIP----DKSIRPNQIFSISLPFPIIDDKsIASKILTLIESKLLRQYGLSSLSREDPNYKPVYKGDRRSRE------ 528 Sulfolobus solf...
AAM06006     575 TVWPWLLGAYVKAYL 589 Methanosarcina acetivorans C2A
WP_010923161 529 SLPQWTHMALVTRRL 543 Sulfolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap