Conserved Protein Domain Family
myb_SHAQKYF

?
TIGR01557: myb_SHAQKYF 
myb-like DNA-binding domain, SHAQKYF class
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
Statistics
?
PSSM-Id: 130620
View PSSM: TIGR01557
Aligned: 10 rows
Threshold Bit Score: 70.1253
Threshold Setting Gi: 4759506
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD29772        14 NPRMHWTDDLDIRFIQVIEKLGGeESATPKRILSLMGVRDLTISHVKSHLQMYRNKK 70  thale cress
BAB10342       223 KRRVVWDEELHQNFLNAVDFLGL-ERAVPKKILDVMKVDYISRENVASHLQVTFLIY 278 thale cress
TIGR:At2g27070 225 KKKIWWTNPLQDLFLQAIQHIGY-DKVVPKKILAIMNVPYLTRENVASHLQKYRLFV 280 thale cress
AAK50391       184 KVKVDWTPELHRRFVQAVEQLGI-DKAVPSRILEIMGTDCLTRHNIASHLQKYRSHR 239 Zea mays
BAB01705       218 NPDLVWTNRLQLVFDDAVVRLGGlFSATPKAINELISEEGLTGDQIRSHLQVLRDRQ 274 thale cress
AAB32591        99 KKGVPWTEEEHRMFLLGLQKLGKgDW---RGIARNYVISR-TPTQVASHAQKYFIRQ 151 potato
CAB42406        22 KQRERWTEDEHERFLEALRLYGR-AW---QRI-EEHIGTK-TAVQIRSHAQKFFTKL 72  unidentified
AAK68834        46 KSRESWTEGEHDKFLEALQLFDR-DW---KKI-EDFVGSK-TVIQIRSHAQKYFLKV 96  thale cress
XP_006303753   180 KQRRCWSSQLHRRFLNALQHLGGpHVATPKQIREFMKVDGLTNDEVKSHLQKYRLHT 236 Capsella rubella
NP_178659       86 KARLRWSSDLHDCFVNAVEKLGGpNKATPKSVKEAMEVEGIALHHVKSHLQKFRLGK 142 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap