Conserved Protein Domain Family
rhamnosyltran

?
TIGR01556: rhamnosyltran 
L-rhamnosyltransferase
This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 130619
View PSSM: TIGR01556
Aligned: 4 rows
Threshold Bit Score: 390.693
Threshold Setting Gi: 152781
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA79349  13 VTFNP---EVEVFKQLIKSIIPQVDQIIIVDNGslCEirSGLEEIVTNYQNLYLISLSDNMGIASAQNYGIKKSFSMESS 89  Yersinia enterocoli...
P37782    10 VTYNP---ELKNLNALITELKEQNCYVVVVDNR--TN--FTLKDKLADIEKVHLICLGRNEGIAKAQNIGIRYSLEKGAE 82  Shigella flexneri
AAA16937  11 ITYNP---DLTILRESYTSLYKQVDKIILIDNN--STnyQELKKLFEKKEKIKIVPLSDNIGLAAAQNLGLNLAIKNNYT 85  Shigella dysenteriae
AHH49911   8 VLFNPgddDLEHLGELAAAFP--QLRFLAVDNSphSD---PQRNARLRGQGIAVLHHGNRQGIAGAFNQGLDALFRRGVQ 82  Pseudomonas aerugin...
CAA79349  90 HVLLLDHDSIPAedmvEKLLSLELKLLSQGr-QVGAVGPTSVDRRTSTRSGFVRKSG-ILIKRIYPDDSKGFVKTDFLIA 167 Yersinia enterocoli...
P37782    83 KIIFFDQDSRIR----NEFIKKLSCYMDNE--NAKIAGPVFIDRDKSHYYPICNIKKnGLREKIHVTEGQTPFKSSVTIS 156 Shigella flexneri
AAA16937  86 YAILFDQDSVLQdngiNSFFFEFEKLVSEEklNIVAIGPSFFDEKTGRRFRPTKFIGpFLYPFRKITTKNPLTEVDFLIA 165 Shigella dysenteriae
AHH49911  83 GVLLLDQDSRPG----GAFLAAQWRNLQARngQACLLGPRIFDRGDRRFLPAIHLDG-LTLRQLSLDGLTTPQRTSFLIS 157 Pseudomonas aerugin...
CAA79349 168 SGTLIRTEVLHNIGLMKENYFIDHVDTEWCFRAVNCGIELFGCGDAFLNHTLGDSVIRIWMgrwREIPKHSPLRNYYIFR 247 Yersinia enterocoli...
P37782   157 SGTMVSKEVFEIVGMMDEELFIDYVDTEWCLRCLNYGILVHIIPDIKMVHAIGDKSVKICG---INIPIHSPVRRYYRVR 233 Shigella flexneri
AAA16937 166 SGCFIKLECIKSAGMMTESLFIDYIDVEWSYRMRSYGYKLYIHNDIHMSHLVGESRVNLGL---KTISLHGPLRRYYLFR 242 Shigella dysenteriae
AHH49911 158 SGCLLTREAYQRLGHFDEELFIDHVDTEYSLRAQALDVPLYVDPRLVLEHRIGTRKTRRLGglsLSAMNHAPLRRYYLAR 237 Pseudomonas aerugin...
CAA79349 248 NTINMVTSTPMSWSWKLAHIYRLMIFFVFFMIAAKPRYRRFIMMIKGGFDG 298 Yersinia enterocolitica
P37782   234 NAFLLLRKNHVPLLLSIREVVFSLIHTTLIIATQKNKIEYMKKHILATLDG 284 Shigella flexneri
AAA16937 243 NYISILKVRYIPLGYKIREGFFNIGRFLVSMIITKNRKTLILYTIKAIKDG 293 Shigella dysenteriae
AHH49911 238 NGLLVLRRYARSSPLALLANLPTLTQGLAVLLLERDKLLKLRCLGWGLWDG 288 Pseudomonas aeruginosa YL84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap