Conserved Protein Domain Family
phge_rel_HI1409

?
TIGR01555: phge_rel_HI1409 
phage-related protein, HI1409 family
This model describes an uncharacterized family of proteins found in prophage regions of a number of bacterial genomes, including Haemophilus influenzae, Xylella fastidiosa, Salmonella typhi, and Enterococcus faecalis. Distantly related proteins can be found in the prophage-bearing plasmids of Borrelia burgdorferi. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130618
View PSSM: TIGR01555
Aligned: 3 rows
Threshold Bit Score: 602.296
Threshold Setting Gi: 488330615
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44183         5 DGIKSLALKLGSKQDQTYYAR-GLSLTDDLM--QIEALWRDNWIANKVCIKRSEDMVRNWRDIFSnDLKSEQLDEFTKLE 81  Haemophilus inf...
WP_010894069  29 DTLQNLVAGLGDQRDKMSYGRyLLPRVIDRV--ELEAMYRTNWLARKVVDIPATDMTREWVTLQT-CMQADALEPMYRLE 105 Xylella fastidiosa
WP_002400000  17 AYRNDFMLGNGKGHARDNLSRqRPGTSKRLScsQLESLYSSNSMAKNIVDIPAEDLTRNGWSLK--MQDDKVKALYESKL 94  Enterococcus fa...
P44183        82 RRLKLRETLTKALQWSSLYGAVGLLVVTDTINITSPLQPTER----LKRLIILPKWK-I-SPTGQRDDDVFSPNFGRYSE 155 Haemophilus inf...
WP_010894069 106 QALNVRAKVRDALAWARLYGGAVLFINVHGQDPSLPFDPASVmpgsRLSLTVLDRWRvA-LGSGQMDQDPLSETYGQPRC 184 Xylella fastidiosa
WP_002400000  95 RQLKAKERLQQLFTYERLYGDGFVSIGTIEKREYSLSEPLDFe--nIKSVPYINAFSgKkISNRIIDEDVFSPNYGQIES 172 Enterococcus fa...
P44183       156 YTITGGt------qSVSVHHSRLLIINANDAP-----LSDNDIWGVSDLEKIIDVLKRFDSASANVGDLIFESKIDIFKI 224 Haemophilus inf...
WP_010894069 185 YQIAGS--------VERVDRSRMIAFSGAELPwe--aFRGNGYWHDSVLQAMYNALSRYDTATQGTASMFFEAVVDVLRI 254 Xylella fastidiosa
WP_002400000 173 FEVNNRsnnsrihlLNNTTYSRATTIHRSRVLhqqnlRFEDELEGSSLLENLYDILTVADTSVWSVGQILYDFIFKVYKS 252 Enterococcus fa...
P44183       225 AGLSDKISAG-LENDVAHVISAVQSIKSATNSLLLDAENEYDRKELSFGGLKDLLTEFRNAVAGAADMPVTILFGQSVSG 303 Haemophilus inf...
WP_010894069 255 SGLSDTLSSDqGTQEVHKRFQLAAMMKSFNRMLLLDAKDEYTQKTNHFSGVKEVIEQFMMDISGAADIPATRLFGQSPKG 334 Xylella fastidiosa
WP_002400000 253 ADVRSLTPQD----KLEIETKMDYQF-RTEAIAIIDKEESLGKESSSVAGIGELLDFVWDYLAGAARMPKTVLKGQEGGT 327 Enterococcus fa...
P44183       304 LAS-GDEDIQNYHESIHRLQETRLRPVLEVLDTLLCNELFGG----QPD--DWWFEFLPLTVVKQEQQVNMLNTFATAAN 376 Haemophilus inf...
WP_010894069 335 MNAtGDSDIRNYYDRIKAQQEDELRPVLRVLYAVLFRASVGE----CPQ--DLEIQFNSLWQMSETERASIEKLRAERDQ 408 Xylella fastidiosa
WP_002400000 328 VTG-AQYDVMNYYSRITAIQENQLRPHLEYLMRCLMWAEDECggrlDPDsiEWSVEFNPLWNVDSKTDAEIRKLTAETDK 406 Enterococcus fa...
P44183       377 TLIQNGVVNEYQVANELRESGLFANI 402 Haemophilus influenzae Rd KW20
WP_010894069 409 IYLAHGVIGPDVPCAELLEQKTYSNL 434 Xylella fastidiosa
WP_002400000 407 IYIEAGVSDPDDVHEARFGRFGITET 432 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap