1B7G,2CZC


Conserved Protein Domain Family
GAPDH-II_archae

?
TIGR01546: GAPDH-II_archae 
Click on image for an interactive view with Cn3D
glyceraldehyde-3-phosphate dehydrogenase, type II
This model describes the type II glyceraldehyde-3-phosphate dehydrogenases which are limited to archaea. These enzymes catalyze the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. In archaea, either NAD or NADP may be utilized as the cofactor. The class I GAPDH's from bacteria and eukaryotes are covered by TIGR01534. All of the members of the seed are characterized. See, for instance. This model is very solid, there are no species falling between trusted and noise at this time. The closest relatives scoring in the noise are the class I GAPDH's.
Statistics
?
PSSM-Id: 130609
View PSSM: TIGR01546
Aligned: 5 rows
Threshold Bit Score: 567.577
Threshold Setting Gi: 6435783
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1B7G_O   4 VAVNGYGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGIRIYVPQQS-IKKFEESGIPVAGTVEDLIKTSDIVV 82  Sulfolobus solfataricus
P20286   5 VGINGYGTIGKRVAYAVTKQDDMELIGVTKTKPDFEAYRAKELGIPVYAASEEfLPRFEKAGFEVEGTLNDLLEKVDIIV 84  Pyrococcus furiosus
P39460   4 VAVNGYGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGIRIYVPQQS-IKKFEESGIPVAGTVEDLIKTSDIVV 82  Sulfolobus solfataric...
P19315   4 VGINGYGTIGKRVADAVSAQDDMKIVGVTKRSPDFEARMAVEKGYDLYISAPErENSFEEAGIKVTGTAEELFEKLDIVV 83  Methanobacterium form...
2CZC_A   5 VGVNGYGTIGKRVAYAVTKQDDMELIGITKTKPDFEAYRAKELGIPVYAASEEfIPRFEKEGFEVAGTLNDLLEKVDIIV 84  Pyrococcus horikoshii...
1B7G_O  83 DTTPNGVGAQYKP-IYLQLQRNAIFQGGEKAEVADISFSALCNYNEALGKKYIRVVSCNTTALLRTICTVNKVskVEKVR 161 Sulfolobus solfataricus
P20286  85 DATPGGMGEKNKQ-LYEKAGVKAIFQGGEKAEVAQVSFVAQANYEAALGKDYVRVVSCNTTGLVRTLNAIKDY--VDYVY 161 Pyrococcus furiosus
P39460  83 DTTPNGVGAQYKP-IYLQLQRNAIFQGGEKAEVADISFSALCNYNEALGKKYIRVVSCNTTALLRTICTVNKVskVEKVR 161 Sulfolobus solfataric...
P19315  84 DCTPEGIGAKNKEgTYEKMGLKATFQGGEKHDQIGLSFNSFSNYKDVIGKDYARVVSCNTTGLCRTLNPINDLcgIKKVR 163 Methanobacterium form...
2CZC_A  85 DATPGGIGAKNKP-LYEKAGVKAIFQGGEKADVAEVSFVAQANYEAALGKNYVRVVSCNTTGLVRTLSAIREYa--DYVY 161 Pyrococcus horikoshii...
1B7G_O 162 ATIVRRAADQKEVKKGPINSLVPDpATVPSHHAKDVNSVIRnLDIATMAVIAPTTLMHMHFINITLKDKVEKKDILSVLE 241 Sulfolobus solfataricus
P20286 162 AVMIRRAADPNDIKRGPINAIKPS-VTIPSHHGPDVQTVIP-INIETSAFVVPTTIMHVHSIMVELKKPLTREDVIDIFE 239 Pyrococcus furiosus
P39460 162 ATIVRRAADQKEVKKGPINSLVPDpATVPSHHAKDVNSVIRnLDIATMAVIAPTTLMHMHFINITLKDKVEKKDILSVLE 241 Sulfolobus solfataric...
P19315 164 AVMVRRGADPSQVKKGPINAIVPNpPTVPSHHGPDVQTVMYdLNITTMALLVPTTLMHQHNLMVELESSVSIDDIKDKLN 243 Methanobacterium form...
2CZC_A 162 AVMIRRAADPNDTKRGPINAIKPT-VEVPSHHGPDVQTVIP-INIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFE 239 Pyrococcus horikoshii...
1B7G_O 242 NTPRIVLISSKYDAEATAELVEVARDLKRDRNDIPEVMIFSDSIYVKDDEVMLMYAVHQESIVVPENIDAIRASMKLMSA 321 Sulfolobus solfataricus
P20286 240 NTTRVLLFEKEKGFESTAQLIEFARDLHREWNNLYEIAVWKESINVKGNRLFYIQAVHQESDVIPENIDAIRAMFEIAEK 319 Pyrococcus furiosus
P39460 242 NTPRIVLISSKYDAEATAELVEVARDLKRDRNDIPEVMIFSDSIYVKDDEVMLMYAVHQESIVVPENIDAIRASMKLMSA 321 Sulfolobus solfataric...
P19315 244 ETPRVLLLKAKEGLGSTAEFMEYAKELGRSRNDLFEIGVWEESLNIVDGELYYMQAIHQESDVVPENVDAIRAMLEMEDN 323 Methanobacterium form...
2CZC_A 240 NTTRVLLFEKEKGFDSTAQIIEFARDLHREWNNLYEIAVWKESINIKGNRLFYIQAVHQESDVIPENIDAIRAMFELADK 319 Pyrococcus horikoshii...
1B7G_O 322 -EDSMRITNESLGIL 335 Sulfolobus solfataricus
P20286 320 -WESIKKTNKSLGIL 333 Pyrococcus furiosus
P39460 322 -EDSMRITNESLGIL 335 Sulfolobus solfataricus P2
P19315 324 pSKSIEKTNKAMGIL 338 Methanobacterium formicicum
2CZC_A 320 -WDSIKKTNKSLGIL 333 Pyrococcus horikoshii OT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap