Conserved Protein Domain Family
YfhB_g-proteo

?
TIGR01545: YfhB_g-proteo 
haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB
This model describes a clade of sequences limited to the gamma proteobacteria. This group is a member of the haloacid dehalogenase (HAD) superfamily of aspartate-dependent hydrolases and all of the conserved catalytic motifs are present. Although structurally similar to subfamily IA in that the variable domain is predicted to consist of five consecutive alpha helices (by PSI-PRED), it is sufficiently divergent to warrant being regarded as a separate sub-family (IF). The gene name comes from the E. coli gene. There is currently no information regarding the function of this gene.
Statistics
?
PSSM-Id: 130608
View PSSM: TIGR01545
Aligned: 2 rows
Threshold Bit Score: 380.44
Threshold Setting Gi: 15980886
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P30133     2 ATHERRVVFFDLDGTLHQQDMFGSFLRYLLRRQPLNALLVLPLLPIIAIALLIKGRAARWPMSLLLWGCTFGHSEARLQT 81  Escherichia coli
CAC92172   6 SAGAKRIIFFDLDGTLHQQDMFGSFLRFLLRHLPLNLLLVIPLLPLIGVGLLVGGRCARWPMSLLLWAMTFGRREAHLRD 85  Yersinia pestis CO92
P30133    82 LQADFVRWFRDNVTAFPLVQERLTTYLLSSDADIWLITGSPQPLVEAVYFDTPWLPRVNLIASQIQRGYGGWVLTMRCLG 161 Escherichia coli
CAC92172  86 LEWRFVAAFRQKVTEFPVVAMRLRQYLESSDAEVWLITGSPQRLVEQVYHDSNFIHRLRLIGSRMERRNGGWVLPLRCLG 165 Yersinia pestis CO92
P30133   162 HEKVAQLERKIGTPLRLYSGYSDSNQDNPLLYFCQHRWRVTPRGELQQLE 211 Escherichia coli
CAC92172 166 PEKVVQLEQRLGSPLKLYSGYSDSKQDNPLLAFCEHRWRVSKTGELQQLE 215 Yersinia pestis CO92
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap