Conserved Protein Domain Family
A118_put_portal

?
TIGR01542: A118_put_portal 
phage portal protein, putative, A118 family
This model represents a family of phage minor structural proteins. The protein is suggested to be the head-tail connector, or portal protein, on the basis of its position in the phage gene order, its presence in mature phage, its size, and its conservation across a number of complete genomes of tailed phage that lack other candidate portal proteins. Several other known portal protein families lack clear homology to this family and to each other. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130605
View PSSM: TIGR01542
Aligned: 3 rows
Threshold Bit Score: 771.389
Threshold Setting Gi: 5823601
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL15070  15 KYVMTTQSLTNITDHPKIAISKLEYDRITTNLKYYKSDWDSVLYLN--TDGETKKRDLNHLPIARTAAKKIASLVFNEQA 92  Temperate phage phi...
AAC00535  16 AAVGMTKSLGQIIDDPRINLPADEVERIARDKRYYMDDFKQVTHKN--SYGDTQKHELQSVNVTKLASAKLASLIFNEQC 93  Lactobacillus phage...
CAB53789  14 RRMGLLKALKDVKDHKKVNANDEDYKYIDMWKRLYQGHYAEWHNLNyeHNGNPVNRRQLSMNLPKVTAKYMSKLLFNEKV 93  Listeria phage A118
AAL15070  93 EIKVDDDAANEFISETLKNDRFNKNFERYLESCLALGGLAMRPYVDGDK-VRVAFVQAPVFLPLQSNTQDVSSAAVVIKS 171 Temperate phage phi...
AAC00535  94 QVTVSDETANDFLDDVFQQNDFYTTFEEKLEEWIALGSGCVRPYVDSGK-IKLAWATADQVYPLQADTNQVNELAIASRT 172 Lactobacillus phage...
CAB53789  94 KINIDDKAAEEFVLNVLKTNGFTKNMERYIEYGEAMGGFVIKVYHDGNKnVKVSFATADCMYPLSNDSENVDECVIAN-- 171 Listeria phage A118
AAL15070 172 VKTINGKEVYYTLIEFHEWqSSDDYVISNELYRSDDKAKVGSRVPLS--EVYKDLKDEAKVTDVTRPIFTYLKTPGMNNK 249 Temperate phage phi...
AAC00535 173 TEVENHRTIYYTLLEFHQW-DHGDYVITNELYRSEAAETVGINVPLNslEQYEGLEPQVKITGLKHPLFAFYRNKGANNK 251 Lactobacillus phage...
CAB53789 172 --SFHKNNKYYTLLEWNEWqG-DVYTVTTELYQSDDPNELGTKVSLT--LLFDDIEPVVPLPDFTRPTFIYIKPNIANNK 246 Listeria phage A118
AAL15070 250 DINSPLGLSIFDNAKTTIDFINTTYDEFMWEVKMGQRRVAVPESLTALTVR-TTDGDVVPRPRFESDQNVYIRMGGr-DL 327 Temperate phage phi...
AAC00535 252 NFTSPMGMSLIDNSYTVIDAINRTHDQFVDEVKKGQRRLIVPAEWLKTGSSyGGQASETHPPMFDPDETVYQAMYG--DA 329 Lactobacillus phage...
CAB53789 247 NLTSPLGISVYANALDTLKTLDLMFDSYYQEFKLGKKKVLVPSSFVKTAVN----LDGSTTQYFDSTDEAFFLYQGdqDD 322 Listeria phage A118
AAL15070 328 DSSAIQDLTTPIRADDYIKAINEGLSLFEMQIGVSAGLFSFDGKSMKTATEIVSENSDTYQMRNSIVALVEQSLKELVIS 407 Temperate phage phi...
AAC00535 330 SEVGFHDATSPIRVADYQATMDFFLREFENQTGLSQGTFTTSPSGIQTATEVVTNNSQTYQTRSSYITQVEKTIKALTYA 409 Lactobacillus phage...
CAB53789 323 NGKAIKDISVEIRSTEFIESINAMLRIYAMQVGLSAGTFTFDENGLKTATEVVSEKSETYQTKNSHSQLIEQGIKEMIVS 402 Listeria phage A118
AAL15070 408 IFEIAKAYDLYQSEVP----SMDN--ISISLDDGVFTDRDAELDYWIKVVNAGFGTREMAIQKVLNVTEEKAQEIAAEIN 481 Temperate phage phi...
AAC00535 410 ILELASVPSFYADGQArwtgDVDSldITINFNDGVFVDQESKRAADLQAVQAQVMPKKQFLMRNYGLDEEEADEWLAQID 489 Lactobacillus phage...
CAB53789 403 ILEVGKFIEAYSGEVV----ELDT--ITVDFDDSIAQDEDTTINRYTNAKNQGMIPLKIALQRAWNITEAEADEWAEMLA 476 Listeria phage A118
AAL15070 482 TGIVDEINQ 490 Temperate phage phiNIH1.1
AAC00535 490 AENSTAEPE 498 Lactobacillus phage LL-H
CAB53789 477 KEKQAEMPN 485 Listeria phage A118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap