2X5J


Conserved Protein Domain Family
E4PD_g-proteo

?
TIGR01532: E4PD_g-proteo 
Click on image for an interactive view with Cn3D
erythrose-4-phosphate dehydrogenase
This model represents the small clade of dehydrogenases in gamma-proteobacteria which utilize NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose. This enzyme activity appears to have evolved from glyceraldehyde-3-phosphate dehydrogenase, whose substrate differs only in the lack of one carbon relative to E4P. Accordingly, this model is very close to the corresponding models for GAPDH, and those sequences which hit above trusted here invariably hit between trusted and noise to the GAPDH model (TIGR01534). Similarly, it may be found that there are species outside of the gamma proteobacteria which synthesize pyridoxine and have more than one aparrent GAPDH gene of which one may have E4PD activity - this may necessitate a readjustment of these models. Alternatively, some of the GAPDH enzymes may prove to be bifunctional in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]
Statistics
?
PSSM-Id: 130595
View PSSM: TIGR01532
Aligned: 4 rows
Threshold Bit Score: 622.299
Threshold Setting Gi: 49086700
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2X5J_O         4 RVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVGD-----DAIRVL 78  Escherichia col...
P11603         4 RVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVGD-----DAIRVL 78  Escherichia coli
WP_001914337   4 RVAINGFGRIGRNVLRAVYESGKRDRIQVVAVNELAKPDAMAHLLQYDTSHGRFGKKISHDQQHIYVHHqngeyDSIRIL 83  Vibrio cholerae
AAT51372       7 RVALNGYGRIGRCVLRALHERPEQLGFEIVALNDLADQASVEYLTRFDSTHGRFPGEVKVDGDCLHING-----DCVKVL 81  synthetic const...
2X5J_O        79 HERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSN--DLDATVVYGVNQDQLRAEHRIVSNASCT 156 Escherichia col...
P11603        79 HERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSN--DLDATVVYGVNQDQLRAEHRIVSNASCT 156 Escherichia coli
WP_001914337  84 HLSEIPLLPWRDLGVDLVLDCTGVYGCQEDGQQHIDAGAKLVLFSHPGAS--DLDNTIIYGVNHETLTAEHKIVSNGSCT 161 Vibrio cholerae
AAT51372      82 RSPTPEAIDWQALRVDLVLECSGQYTNRAQAERFLRAGAPRVLFSQPMASeaDIDATIVYGVNQQDLSGRETLVSNASCT 161 synthetic const...
2X5J_O       157 TNCIIPVIKLLDDAYGIESGTVTTIHSAMHDQQVIDAYHP-DLRRTRAASQSIIPVDTKLAAGITRFFPQFNDRFEAIAV 235 Escherichia col...
P11603       157 TNCIIPVIKLLDDAYGIESGTVTTIHSAMHDQQVIDAYHP-DLRRTRAASQSIIPVDTKLAAGITRFFPQFNDRFEAIAV 235 Escherichia coli
WP_001914337 162 TNCIVPIIKVLDDAFGIDSGTITTIHSSMNDQQVIDAYHN-DLRRTRAASQSIIPVDTKLHKGIERIFPKFSNKFEAISV 240 Vibrio cholerae
AAT51372     162 TNCGVPLLKLLNEAIGLEYVSITTIHSAMNDQPVIDAYHHeDLRRTRSAFQSVIPVSTGLARGIERLLPELAGRIQAKAI 241 synthetic const...
2X5J_O       236 RVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQ-GAFHGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLIKTLV 314 Escherichia col...
P11603       236 RVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQ-GAFHGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLIKTLV 314 Escherichia coli
WP_001914337 241 RVPTVNVTAMDLSVTIKSNVKVNDVNQTIVNASQ-CTLRGIVDYTEAPLVSIDFNHDPHSAIVDGTQTRVSNGQLVKMLV 319 Vibrio cholerae
AAT51372     242 RVPTVNVSALDITLQTSRDTSAAEINRVLREAAEsGPLRGLLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLA 321 synthetic const...
2X5J_O       315 WCDNEWGFANRMLD 328 Escherichia coli K-12
P11603       315 WCDNEWGFANRMLD 328 Escherichia coli
WP_001914337 320 WCDNEWGFANRMLD 333 Vibrio cholerae
AAT51372     322 WFDNEWGFANRMLD 335 synthetic construct
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap