1F9N,3ERE


Conserved Protein Domain Family
argR_whole

?
TIGR01529: argR_whole 
Click on image for an interactive view with Cn3D
arginine repressor
This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130592
View PSSM: TIGR01529
Aligned: 11 rows
Threshold Bit Score: 174.823
Threshold Setting Gi: 8134310
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1F9N_A         4 GQRHIKIREIITSNEIETQDELVDMLKQDGYK-VTQATVSRDIKELHLVKVPTNNG-SYKYSLPADQ-----RFNPLSKL 76  Bacillus subtilis
Q9WW19         6 KRRQELIRKIIHEKKISNQFQIVEELKKYGIK-AVQPTVARDLKEIGAVKIMDESG-NYVYKLLDETp----VIDPWKEL 79  Thermotoga mari...
P17893         4 GQRHIKIREIITSNEIETQDELVDMLKQDGYK-VTQATVSRDIKELHLVKVPTNNG-SYKYSLPADQ-----RFNPLSKL 76  Bacillus subtil...
Q54870         4 RDRHQLIKKMITEEKLSTQKEIQDRLEAHNVC-VTQTTLSRDLREIGLTKVKKNDM-VY-YVLVN--------ETEKIDL 72  Streptococcus p...
P15282         8 EELVKAFKALLKEEKFSSQGEIVAALQEQGFDnINQSKVSRMLTKFGAVRTRNAKM-EMVYCLPAEL------GVPTTSS 80  Escherichia coli
Q9Z8Z1         5 VTIDEALKEILRLEGAATQEELCAKLLAQGFA-TTQSSVSRWLRKIQAVKVAGERG--ARYSLPSST----------EKT 71  Chlamydia pneum...
P94992        19 AGRQARIVAILSSAQVRSQNELAALLAAEGIE-VTQATLSRDLEELGAVKLRGADGgTGIYVVPEDGspvrgVSGGTDRM 97  Mycobacterium t...
WP_010887387  23 DQRQKRIQDIILRESVSTQAELVKLLAKEGVQ-VTQATVSRDINELRLVRVPIGKG-RHRYALAQYGg----DSDIEEQL 96  Deinococcus rad...
WP_002982171   4 MERQQQIKRIIQAEHIGTQEDIKNHLQKEGIV-VTQATLSRDLREIGLLKLRDEQG-KLYYSLS---------EPVATPF 72  Streptococcus p...
3ERE_D        19 AGRQARIVAILSSAQVRSQNELAALLAAEGIE-VTQATLSRDLEELGAVKLRGADGgTGIYVVPEDGspvrgVSGGTDRM 97  Mycobacterium t...
WP_004254487   4 DKRLEIIKEIVTNNKISTQEELQSLLLERGVE-VTQATLSRDIRKLNIIKKRDKGE-SF-YSFLTSG-----NSKINSDL 75  Lactococcus lactis
1F9N_A        77 KRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDW--DEMMGTICGDDTILIICRTPEDTEGVKNRLLELL 149 Bacillus subtilis
Q9WW19        80 KRNFKSFVESIDRAGNLIVIKTIPGTASGIARVIDRLDI--DEIVGTLAGDDTIFVAVRDPESCEKIVEKLSSIL 152 Thermotoga maritima ...
P17893        77 KRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDW--DEMMGTICGDDTILIICRTPEDTEGVKNRLLELL 149 Bacillus subtilis su...
Q54870        73 VEFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKD--EWILGTVAGANTLLVICRDQHVAKLMEDRLLDLM 145 Streptococcus pneumo...
P15282        81 --PLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKa-EGILGTIAGDDTIFTTPANGFTVKDLYEAILELF 152 Escherichia coli
Q9Z8Z1        72 --TTRHLVLSIRHNASLIVIRTVPGSASWIAALLDQGLK--DEILGTLAGDDTIFVTPIDEGRLPLLMVSIANLL 142 Chlamydia pneumoniae
P94992        98 ARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAAL--PQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR 170 Mycobacterium tuberc...
WP_010887387  97 ARLFQSFVQDVDRGENILVIRTADGHASGVALLLDRWKR--DDIVGTLAGEDTIMVVARSTHDGESLMEEFNALM 169 Deinococcus radiodurans
WP_002982171  73 SPEVRFYVLKVDRAGFMLVLHTNLGEADVLANLIDNDAI--EDILGTIAGADTLLVICRDEEIAKRFEKDLAAGL 145 Streptococcus pyogenes
3ERE_D        98 ARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAAL--PQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR 170 Mycobacterium tuberc...
WP_004254487  76 QLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDsrTDILGTIAGADTLLVICASEKAANILTAEIKYIL 150 Lactococcus lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap