Conserved Protein Domain Family
ATPase-IIIB_Mg

?
TIGR01524: ATPase-IIIB_Mg 
magnesium-translocating P-type ATPase
This model describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms. These transporters are active in low external Mg2+ concentrations and pump the ion into the cytoplasm. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130587
View PSSM: TIGR01524
Aligned: 3 rows
Threshold Bit Score: 1480.5
Threshold Setting Gi: 499299092
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P36640        35 NATIPPSLSERCLKVAAMEQETLWRvFDTHPEGLNAAEVTRAREKHGENRLPAQKPSPWWVHLWVCYRNPFNILLTILGG 114 Salmonella ente...
AAA72084      18 NDKQHKKVFPIEAEAFHSPEETLAR-LNSHRQGLTIEEASERLKVYGRNEVAHEQVPPALIQLLQAFNNPFIYVLMALAG 96  Salmonella ente...
WP_010990042   2 KKLHVKKQGNNLLKESQMGKEKVLEkLGVMETGLTNVEVTERLAEFGPNQTVEEKKVSNLRLFIRAFNDPFIYILAMLMV 81  Listeria monocy...
P36640       115 ISYAT-----------EDLFAAGVIALMVGISTLLNFVQEARSTKAADALKAMVSNTATVLRVINENGENAWLELPIDQL 183 Salmonella ente...
AAA72084      97 VSFITdywlplrrgeeTDLTGVLIILTMVSLSGLLRFWQEFRTNRAAQALKKMVRTTATVLRRGPGNIGAVQEEIPIEEL 176 Salmonella ente...
WP_010990042  82 VSYLT-----------DDMEATVIMALMILASGILGFIQTSRAERASYALKNMVKNRVNVIR------NGSMDLVMQDAI 144 Listeria monocy...
P36640       184 VPGDIIKLAAGDMIPADLRIIQARDLFVAQASLTGESLPVEKVAATREP----------RQNNPLECDTLCFMGTNVVSG 253 Salmonella ente...
AAA72084     177 VPGDVVFLAAGDLVPADVRLLASRDLFISQSILSGESLPVEKYDVMADVagkdseqlpdKDKSLLDLGNICLMGTNVTSG 256 Salmonella ente...
WP_010990042 145 VPGDLIEISAGDIIPADARVISATDLLINQSALTGESIPAEKFVEDKRA-----------DPEIFERENLLFMGTDVLSG 213 Listeria monocy...
P36640       254 TAQAVVMATGAGTWFGQLAGRVSEqDNEQNAFQKGISRVSMLLIRFMLVMAPVVLIINGYTKGDWWEAALFALSVAVGLT 333 Salmonella ente...
AAA72084     257 RAQAVVVATGSRTWFGSLAKSIVG-TRTQTAFDRGVNSVSWLLIRFMLIMVPVVLLINGFSKGDWVEASLFALAVAVGLT 335 Salmonella ente...
WP_010990042 214 HGRAVVLRTGSSTFFGSLSIAATE-RRGDTSFDKGVKSISKLLFYFMMVMVPIVFMINGLMKGNWLEAFLYAVAIAVGLT 292 Listeria monocy...
P36640       334 PEMLPMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKPSEHVLHCAWLNSHY 413 Salmonella ente...
AAA72084     336 PEMLPMIVSSNLAKGAIAMSRRKVIVKRLNAIQNFGAMDVLCTDKTGTLTQDNIFLEHHLDVSGVKSSRVLMLAWLNSSS 415 Salmonella ente...
WP_010990042 293 PEMLPMIVSTNLAKGAINMSKKKVIMKELSAIQNIGAMDILCTDKTGTLTEDKLELIKYIDSAGETSERVLKMAYLNSYF 372 Listeria monocy...
P36640       414 QTGLKNLLDTAVLEGVDETAARQLSGRWQKIDEIPFDFERRRMSVVVAEDSN-VHQLVCKGALQEILNVCTQVRHNGDIV 492 Salmonella ente...
AAA72084     416 QSGARNVMDRAILRFGEGRIAPSTKARFIKRDELPFDFVRRRVSVLVEDAQHgDRCLICKGAVEEMMMVATHLREGDRVV 495 Salmonella ente...
WP_010990042 373 QTGWKNVLDHAVIAKLDES----TASGWKKVGEIPFNFDRRRLSVVVENRAE--TRMITKGAVEEMLTVCTHKEFGGAVS 446 Listeria monocy...
P36640       493 PLDDNMLRRVKRVTDTLNRQGLRVVAVATKYLPAREGD--YQRIDESDLILEGYIAFLDPPKETTAPALKALKASGITVK 570 Salmonella ente...
AAA72084     496 ALTETRRELLLAKTEDYNAQGFRVLLIATRKLDGSGNNptLSVEDETELTIEGMLTFLDPPKESAGKAIAALRDNGVAVK 575 Salmonella ente...
WP_010990042 447 TLSESEKSELQDMCAEMNRSGIRVIAVAYKTGKVGEA---FTKTDEEQMIIAGFLGFRDPVKASTKEAIAHLFKNQINVK 523 Listeria monocy...
P36640       571 ILTGDSELVAAKVCHEVGLDAGDVIIGSDIEGLSDDALAALAARTTLFARLTPMHKERIVTLLKREGHVVGFMGDGINDA 650 Salmonella ente...
AAA72084     576 VLTGDNPVVTARICLEVGIDTHDILTGTQVEAMSDAELASEVEKRAVFARLTPLQKTRILQALQKNGHTVGFLGDGINDA 655 Salmonella ente...
WP_010990042 524 VLTGDNEIVTKRICQEVGIPANGFLLGADIEELSDEELTRELRKYHIFAKLTPMQKSRIIGLLKKAGHTVGFLGDGINDA 603 Listeria monocy...
P36640       651 PALRAADIGISVDGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFSNMLKYIKMTASSNFGNVFSVLVASAFLPFLPML 730 Salmonella ente...
AAA72084     656 PALRDADVGISVDSAADIAKESSDIILLEKDLMVLEEGVIKGRETFGNIIKYLNMTASSNFVNVFSVLVASAFIPFLPML 735 Salmonella ente...
WP_010990042 604 PALRKADVGISVDTAADITKDASSVILLEKSLTVLNDAVMEGRNVFGNILKYLKMTASSNFGNVFSVLVASAFIPFLPML 683 Listeria monocy...
P36640       731 PLHLLIQNLLYDVSQVAIPFDNVDEEQIQKPQRWNPADLGRFMVFFGPISSIFDILTFCLMWWVFHANTPETQTLFQSGW 810 Salmonella ente...
AAA72084     736 AIHLLIQNLMYDISQLSLPWDKMDKEFLRKPRKWDAKNIGRFMLWIGPTSSIFDITTFALMWYVFAANNVEAQALFQSGW 815 Salmonella ente...
WP_010990042 684 SLHLLLQNLLYDFSQLTLPWDKMDRSFLKKPHQWEQKGMLRFILCIGPVSSIFDIATFLIMWFVFSANTVAEQALFHSGW 763 Listeria monocy...
P36640       811 FVVGLLSQTLIVHMIRTRRLPFIQSRAAWPLMAMTLLVMVVGVSLPFSPLASYLQLQALPLSYFPWLIAILVGYMTLTQL 890 Salmonella ente...
AAA72084     816 FIEGLLSQTLVVHMLRTQKIPFIQSRATLPVLLTTGLIMAIGIYIPFSPLGAMVGLEPLPLSYFPWLVATLLSYCLVAQG 895 Salmonella ente...
WP_010990042 764 FVVGLLTQTLVVHMIRTEKIPFIQSRAAAPVMIATLSVMALGIIIPFTGFGHSIGFVSLPGSYFPWLILILVGYMATMQL 843 Listeria monocy...
P36640       891 VKGFYSRRYGWQ 902 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAA72084     896 MKRFYIKRFGQW 907 Salmonella enterica subsp. enterica serovar Typhimurium
WP_010990042 844 VKTIYIRKFREW 855 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap