Conserved Protein Domain Family
ATPase-IID_K-Na

?
TIGR01523: ATPase-IID_K-Na 
potassium and/or sodium efflux P-type ATPase, fungal-type
Initially described as a calcium efflux ATPase, more recent work has shown that the S. pombe CTA3 gene is in fact a potassium ion efflux pump. This model describes the clade of fungal P-type ATPases responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID. The Leishmania sequence (GP|3192903), which falls between trusted and noise in this model, may very well turn out to be an active potassium pump.
Statistics
?
PSSM-Id: 130586
View PSSM: TIGR01523
Aligned: 2 rows
Threshold Bit Score: 1924.78
Threshold Setting Gi: 19112038
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_010325   11 NAEFNAYHTLTAEEAAEFIgTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHD 90   Saccharomyces ce...
NP_595246    5 NISNPVYFSDIKDVESEFL-TSIPNGLTHEEAQNRLSEYGENRLEADSGVSAWKVLLRQVLNAMCVVLILAAALSFGTTD 83   Schizosaccharomy...
NP_010325   91 WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETK 170  Saccharomyces ce...
NP_595246   84 WIEGGVISAIIVLNITVGFIQEYKAEKTMDSLRTLASPMAHVTRSSKTDAIDSHLLVPGDVVVLKTGDVVPADLRLVETV 163  Schizosaccharomy...
NP_010325  171 NFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISR- 249  Saccharomyces ce...
NP_595246  164 NFETDEALLTGESLPVIKDAHATFQMNEDVPIGDRINLAYSSSIVTKGRAKGICYATGMQTQIGAIAAGLRQKGKLFQRp 243  Schizosaccharomy...
NP_010325  250 ---DPSKSWLQNTWIS--TKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSM 324  Saccharomyces ce...
NP_595246  244 ekdEPNYRRKLNKYYLkvTSYYVQRVLGLNVGTPLQRKLTVLAYILFCIAIILAIIVMAAHSFHVTNEVSIYAISLGISI 323  Schizosaccharomy...
NP_010325  325 IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSdDPFNPN 404  Saccharomyces ce...
NP_595246  324 IPESLIAVLSITMAMGQKNMSKRRVIVRKLEALEALGGVTDICSDKTGTITQGKMITRRVWIPSYGYLSVDTS-DANNPT 402  Schizosaccharomy...
NP_010325  405 EGNVSLIprfspyeyshnEDGDVGILQNFKDRLYEKDlPEDIDMDLFQKWLETATLANIATVFkDDATDCWKAHGDPTEI 484  Saccharomyces ce...
NP_595246  403 IGTVSGL-----------EAAMQDVLKEKKQEMKNID-PSNQPSDQFIPLLKTCALCNLSTVN-QTETGEWVVKGEPTEI 469  Schizosaccharomy...
NP_010325  485 AIQVFATKMDLphnaltGEKSTNQSNEndqsslsqhnekpgsaqfeHIAEFPFDSTVKRMSSVYYNNHNEtYNIYGKGAF 564  Saccharomyces ce...
NP_595246  470 ALHVFSKRFNY------GKEDLLKTNT-------------------FVREYPFDSEIKRMAVIYEDQQGQ-YTVYAKGAV 523  Schizosaccharomy...
NP_010325  565 ESIISCCSSWYGkdgvkiTPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNddqlknITSNRATAESDLVFLGL 644  Saccharomyces ce...
NP_595246  524 ERILERCSTSNG------STLEEPDRELIIAQMETLAAEGLRVLALATKVIDKADNW------ETLPRDVAESSLEFVSL 591  Schizosaccharomy...
NP_010325  645 IGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTnLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLP 724  Saccharomyces ce...
NP_595246  592 VGIYDPPRTESKGAVELCHRAGIRVHMLTGDHPETAKAIAREVGIIPP-FISDRDPNMSWMVMTGSQFDALSDEEVDSLK 670  Schizosaccharomy...
NP_010325  725 VLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEE 804  Saccharomyces ce...
NP_595246  671 ALCLVIARCAPQTKVKMIEALHRRKAFVAMTGDGVNDSPSLKQANVGIAMGQNGSDVAKDASDIVLTDDNFSSIVNAIEE 750  Schizosaccharomy...
NP_010325  805 GRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDS 884  Saccharomyces ce...
NP_595246  751 GRRMFDNIMRFVLHLLVSNVGEVILLVVGLAFRDEVHLSVFPMSPVEILWCNMITSSFPSMGLGMELAQPDVMERLPHDN 830  Schizosaccharomy...
NP_010325  885 EVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDM 964  Saccharomyces ce...
NP_595246  831 KVGIFQKSLIVDMMVYGFFLGVVSLMTWVVIMYGFGTGNLSYDCNAHYHAGCNDVFKARSAVFAVVTFCILIMAVEVKNF 910  Schizosaccharomy...
NP_010325  965 RRSFFRMH--PDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAEL 1042 Saccharomyces ce...
NP_595246  911 DNSLFNLHgiPWGEWNFRYFLHTLVENKFLAWAIALAAVSVFPTIYIPVINRDVFKHTYIGWEWGVVAVAVMFYFFYVEI 990  Schizosaccharomy...
NP_010325 1043 YKCGKRRYFKTQR 1055 Saccharomyces cerevisiae S288c
NP_595246  991 WKSIRRSLTNPQK 1003 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap