Conserved Protein Domain Family
ATPase-IIA2_Ca

?
TIGR01522: ATPase-IIA2_Ca 
golgi membrane calcium-translocating P-type ATPase
This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.
Statistics
?
PSSM-Id: 130585
View PSSM: TIGR01522
Aligned: 4 rows
Threshold Bit Score: 1570.21
Threshold Setting Gi: 19111890
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_011348  35 SLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNI 114  Saccharomyces cer...
NP_595098   2 SVQYDAFSVEQTCADLETDMYNGLSSLQEITRRNKVHGDNDLKVEDEENMVVQFLKQFVKDPLILLLFASSAISVTLGNI 81   Schizosaccharomyc...
XP_503736  24 SAQYCQMTVEETCSKLQTNPETGLTSSQEAMHRRDIHGSNEFAQEEEDSLIKKFFEQFSENPLLLLLIGAAAVSFFMGNH 103  Yarrowia lipolyti...
AAF26295   23 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNKFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 100  human
NP_011348 115 DDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAID 194  Saccharomyces cer...
NP_595098  82 DDAISIALAIVIVVTVGFVQEYRSEQSLKALNNLVPHYCNVIRSGKTEHIVASKLVPGDLVILQIGDRVPADLRIVEATE 161  Schizosaccharomyc...
XP_503736 104 DDAISITLAILIVTTVGFVQEYRSEKSLEALNKLVPPEAHLIRAGNSQTVLASTLVPGDLVEFSVGDRIPADCRIVKAVH 183  Yarrowia lipolyti...
AAF26295  101 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 180  human
NP_011348 195 LSIDESNLTGENEPVHKTSQTIEKssfndqpnsivpISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEK 274  Saccharomyces cer...
NP_595098 162 LEIDESNLTGENSPRKKSSEAISSni---------sLTERNNIAFMGTLVRHGHGRGIVVATGSDTEFGRVFLTMQQTEK 232  Schizosaccharomyc...
XP_503736 184 LSIDESNLTGETTPVTKDTNPVTGtpp-------igLADRTNTAYMGTLVRDGNGTGIVVGTGSHTAFGAVYDMVSEIST 256  Yarrowia lipolyti...
AAF26295  181 LSIDESSLTGETTPCSKVTAPQPAatn-------gdLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEA 253  human
NP_011348 275 PKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVR 354  Saccharomyces cer...
NP_595098 233 PKTPLQNSMDDLGKQLSLISLIGIAVIVLVGFFQGKNWLEMLTIGVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIIR 312  Schizosaccharomyc...
XP_503736 257 PKTPLQASMDNLGKDLSLVSFGVIGVICLIGMFQGRDWLEMFTIGVSLAVAAIPEGLPIIVTVTLALGVLRMSRQKAIVR 336  Yarrowia lipolyti...
AAF26295  254 PKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVK 333  human
NP_011348 355 RLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDsmsnK---LNVLSL------------------Dknkktknsngn 413  Saccharomyces cer...
NP_595098 313 RLPSVETLGSVNVICSDKTGTLTMNHMTVTKIYTCG----M---LAAFSL------------------Pesehie----- 362  Schizosaccharomyc...
XP_503736 337 KLPSVETLGSVNVICSDKTGTLTRNHMSCTTCWTVD----MgdlANAVTLkpgqshteadpkavaalkN----------- 401  Yarrowia lipolyti...
AAF26295  334 KLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDglhtE---VTGVGY------------------Nqfgevivdgdv 392  human
NP_011348 414 lknylTEDVRETLTIGNLCNNASFSQEHAIFLGN-------PTDVALLEQLANFEMPDIRNTVQKVQELPFNSKRKLMAT 486  Saccharomyces cer...
NP_595098 363 lsvrrTVGIEKALLAAALCNNSKVHNKADSILDTtcpwagfPVDVALIECSERFGLKDPRETYSRISEVSFSSERKYMSV 442  Schizosaccharomyc...
XP_503736 402 -----SVSLANMLKVGNLCNNSKFNREAGHLVGN-------ATDIALIEVLDYFGLEDTRETRKRVAEVPFSSSRKWMLT 469  Yarrowia lipolyti...
AAF26295  393 vhgfyNPAVSRIVEAGCVCNDAVIRNN--TLMGK-------PTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAV 463  human
NP_011348 487 KILNp--vDNK--CTVYVKGAFERILEYSTSYLKSKGKkTEKLTEAQKATINECANSMASEGLRVFGFAKLTLsdsstpl 562  Saccharomyces cer...
NP_595098 443 AVQY----NSS--KMNFMKGATEQVLSSCAYFSDQDGV-QHELTAEMKENIQRNEFEMAASGLRIIAVASGIN------- 508  Schizosaccharomyc...
XP_503736 470 STTT----GDSstPMISVKGAGEVIAPFCEYYCKKDGK-TAPFNDDMRKKVTEIASEMSNDGLRIIAFAYKQG------- 537  Yarrowia lipolyti...
AAF26295  464 KCVHrtqqDRP--EICFMKGAYEQVIKYCTTYQSK-GQ-TLTLTQQQRDVYQQEKARMGSAGLRVLALASGPE------- 532  human
NP_011348 563 tedliKD----------LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKlsvlS- 631  Saccharomyces cer...
NP_595098 509 -----TNk---------LVFHGLFGINDPPRPQVRESVQYLMTGGVRVIMITGDSVVTAISIARSLGMAIPSND----Ee 570  Schizosaccharomyc...
XP_503736 538 -----KYeegseeapegLVFAGLMGLYDPPRPDVPRAIRRLTTGGVRVVMITGDSAATALSIGRRIGMPLMPGT----Qs 608  Yarrowia lipolyti...
AAF26295  533 -----LGq---------LTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQ----Sv 594  human
NP_011348 632 --------GDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTD 703  Saccharomyces cer...
NP_595098 571 airnyaltGAQLDDLDSSSLRDAVSRVVVFARTTPQHKMKIVEALQSLGDVVAMTGDGVNDAPALKLADIGIAMGRQGTD 650  Schizosaccharomyc...
XP_503736 609 v-----veGSKLATMSDQALDECLQTASIFARTSPEDKMKIVKGFQRRGDVVAMTGDGVNDAPALKLADIGIAMGQGGTD 683  Yarrowia lipolyti...
AAF26295  595 -------sGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTD 667  human
NP_011348 704 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQ 783  Saccharomyces cer...
NP_595098 651 VAKEAADMILTDDSFATILSAVEEGKGIFNNIKNFITFQLSTSVAALSLIAISSVFGFQNPLNAMQILWINILMDGPPAQ 730  Schizosaccharomyc...
XP_503736 684 VAKEAADMILTDDDFATILSAIEEGKGIFNNIRNFITFQLSTSMAALSIVAVATIMGLENPLNPMQILWINILMDGPPAQ 763  Yarrowia lipolyti...
AAF26295  668 VCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQ 747  human
NP_011348 784 SLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAeDGKVTARDTTMTFTCFVFFDMFNALAC 863  Saccharomyces cer...
NP_595098 731 SLGVESVDEDVMMKPPRPRNAPIISVQLLQRVLLSAFIIVTVTIVVFRVQMQ-DGNVTARDTTMTFTCFVFFDMFNALAC 809  Schizosaccharomyc...
XP_503736 764 SLGVEPVDPDVMNKPPRPRNEKVMTPDLVKKCVEAAVIILVGTMLVYVTQMQ-DGVIDKRDTTMTFTCFVFYDMFNALAC 842  Yarrowia lipolyti...
AAF26295  748 SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELR-DNVITPRDTTMTFTCFVFFDMFNALSS 826  human
NP_011348 864 RHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKN 940  Saccharomyces cerevi...
NP_595098 810 RSETKSVFKLGIFSNRMFNIAVGGSLIGQALVVYASPFQRIFQTEAIGLKDVLILLACTSSVLWVDEIRKWYRRRKG 886  Schizosaccharomyces ...
XP_503736 843 RSATKSVFEIGFFSNKMFLYACGASIIGQLAVVYVPFLQSVFQTEALSVKDLLSLVLISSSVWILDEAKKYFLKSRS 919  Yarrowia lipolytica ...
AAF26295  827 RSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSRE 903  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap