Conserved Protein Domain Family
FruBisAldo_II_B

?
TIGR01521: FruBisAldo_II_B 
fructose-bisphosphate aldolase, class II, Calvin cycle subtype
Members of this family are class II examples of the enzyme fructose-bisphosphate aldolase, an enzyme both of glycolysis and (in the opposite direction) of the Calvin cycle of CO2 fixation. A deep split separates the tightly conserved yeast/E. coli/Mycobacterium subtype (all species lacking the Calvin cycle) represented by model TIGR01520 from a broader group of aldolases that includes both tagatose- and fructose-bisphosphate aldolases. This model represents a distinct, elongated, very well conserved subtype within the latter group. Most species with this aldolase subtype have the Calvin cycle.
Statistics
?
PSSM-Id: 130584
View PSSM: TIGR01521
Aligned: 3 rows
Threshold Bit Score: 677.416
Threshold Setting Gi: 17366285
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9I5Y1   3 LISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQ 82  Pseudomonas aeruginos...
Q55664   3 LVPMRLLLDHAAENGYGIPAFNVNNMEQIISIMQAADETDSPVILQASRGARSYAGENFLRHLVLGAVETYPHIPIAMHQ 82  Synechocystis sp. PCC...
P58336   3 RITLRQLLDHAAERSYGVPAFNINNMEQGLAIMEAARASDAPVILQVSRGARSYANDVMLAKMMEALEEMYPDIPLCIHQ 82  Sinorhizobium melilot...
Q9I5Y1  83 DHGTSPDVCQRSIQLGFSSVMMDGSLREDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGA 162 Pseudomonas aeruginos...
Q55664  83 DHGNSPATCYSAIRNGFTSVMMDGSLEADAKTPASFEYNVNVTAEVVKVAHSVGASVEGELGCLGSLETGQGEAEDGHGF 162 Synechocystis sp. PCC...
P58336  83 DHGNNVATCLTAIQHGFTSVMMDGSLKEDAKTPADYDYNVSITAEVSRLAHMVGASVEGELGCLGSLETGHGEAEDGHGF 162 Sinorhizobium melilot...
Q9I5Y1 163 EGVLDHSQLLTDPEEAADFVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHARIPDTHLVMHGSSSVPQDWL 242 Pseudomonas aeruginos...
Q55664 163 EGKLDHSQLLTDPEEAVEFVNKTQVDALAVAIGTSHGAYKFTRKPTGEVLAISRIEEIHRLLPNTHLVMHGSSSVPQEWI 242 Synechocystis sp. PCC...
P58336 163 EGALDRSQLLTDPDEAARFVAETGVDALAVAIGTSHGAYKFTRKPTGEVLAMDVIEKIHERLPDTHIVMHGSSSVPQEWQ 242 Sinorhizobium melilot...
Q9I5Y1 243 AIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAIRRFLAQNPSEFDPRKYFSKTVEAMRDICIARYEA 322 Pseudomonas aeruginos...
Q55664 243 DMINEFGGAIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAFREAAAKDPKNFDPRHFLKPSIKYMKQVCADRYQQ 322 Synechocystis sp. PCC...
P58336 243 DVFNAHGGQMRETYGVPVEEIVRGIRFGVRKVNIDTDLRLAAAAAFRRVADTSRSEFDPRKFLKPAMDAMSAVCKARFEA 322 Sinorhizobium melilot...
Q9I5Y1 323 FGTAGNASKIKPISLEGMFQRYARGEL 349 Pseudomonas aeruginosa PAO1
Q55664 323 FWTAGNASKIKQLTLDDYAAKYAKGEL 349 Synechocystis sp. PCC 6803 substr. Kazusa
P58336 323 FGTAGNASRIKVVPMPEMARRYASGSL 349 Sinorhizobium meliloti 1021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap