1B57


Conserved Protein Domain Family
FruBisAldo_II_A

?
TIGR01520: FruBisAldo_II_A 
Click on image for an interactive view with Cn3D
fructose-bisphosphate aldolase, class II, yeast/E. coli subtype
Members of this family are class II examples of the glycolytic enzyme fructose-bisphosphate aldolase (FBA). This model represents one of two deeply split, architecturally distinct clades of the family that includes class II fructose-bisphosphate aldolases, tagatose-bisphosphate aldolases, and related uncharacterized proteins. This family is well-conserved and includes characterized FBA from Saccharomyces cerevisiae, Escherichia coli, and Corynebacterium glutamicum. Proteins outside the scope of this model may also be designated as class II fructose-bisphosphate aldolases, but are well separated in an alignment-based phylogenetic tree. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 130583
View PSSM: TIGR01520
Aligned: 6 rows
Threshold Bit Score: 536.327
Threshold Setting Gi: 6686367
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1B57_A     3 IFDFVK--PG-VITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQ 79  Escherichia coli
P11604     4 IFDFVK--PG-VITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQ 80  Escherichia coli
O51401     3 VLDKIK--PG-VVYGKELHFLYEICKKEGFAIPSINCIGTNSINAVLEAAKEINSPIMIQFSNSGSAFISGKGLKMEKPQ 79  Borrelia burgdorfer...
O06313     1 ----MP-----IATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKD---- 67  Mycobacterium tuber...
AAB00930   5 IPEHKQnlTFsLPLGDDVLKLFQYAREKQFAIPACNVTSSSTAVAALEAARDQKAPSSLQTSQGCAAFFAGKGIKDSAEK 84  Neurospora crassa
P14540     3 VEQILKrkTG-VIVGEDVHNLFTYAKEHKFAIPAINVTSSSTAVAALEAARDSKSPIILQTSNGGAAYFAGKGISNEGQN 81  Saccharomyces cerev...
1B57_A    80 Ga-AILGAISGAHHVHQMAEHYGVPVI-LHTDHCAKKLLp-WIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEI 156 Escherichia coli
P11604    81 Ga-AILGAISGAHHVHQMAEHYGVPVI-LHTDHCAKKLLp-WIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEI 157 Escherichia coli
O51401    80 Gv-SIVGAISGAMHVHLMAEHYGVPVV-LHTDHCAKNLLp-WVEGLLEYGEKYYSQHKKPLFSSHMLDLSEEPIKENIEI 156 Borrelia burgdorfer...
O06313    68 ---MVTGAVALAEFTHVIAAKYPVNVA-LHTDHCPKDKLdsYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAI 143 Mycobacterium tuber...
AAB00930  85 ArdSVAGAIAAAHYIRSIAPIYGIPVVrIHTDHCAKKLL--FGDGIPEEDEKFFKANGVPLFSSHMIDLSEEPVEENIST 162 Neurospora crassa
P14540    82 A--SIKGAIAAAHYIRSIAPAYGIPVV-LHSDHCAKKLLp-WFDGMLEADEAYFKEHGEPLFSSHMLDLSEETDEENIST 157 Saccharomyces cerev...
1B57_A   157 CSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSK-ISPRFTIAASFGNVHGVYkPGNVV 235 Escherichia coli
P11604   158 CSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSK-ISPRFTIAASFGNVHGVYkPGNVV 236 Escherichia coli
O51401   157 SKKFLERMAKIEMFLEIELGITGGEEDGVDNSDRALHELFSTPEDIYYGYSELLK-VSPNFQIAAAFGNVHGVYkPGNVK 235 Borrelia burgdorfer...
O06313   144 AQELLKAAAAAKIILEIEIGVVGGEEDGVANEIN--EKLYTSPEDFEKTIEALGAgEHGKYLLAATFGNVHGVYkPGNVK 221 Mycobacterium tuber...
AAB00930 163 CVKYLKRMAPMKQWLEMEIGITGGEEDGVDNSEVDNASLYTQPEDIWQIEEDSRP-ISPYFSIGAGFGNVHGVYaPGNVK 241 Neurospora crassa
P14540   158 CVKYFKRMAAMDQWLEMEIGITGGEEDGVNNENADKEDLYTKPEQVYNVYKALHP-ISPNFSIAAAFGNCHGLY-AGDIA 235 Saccharomyces cerev...
1B57_A   236 LTPTILRDSQEYVSKKHNLP--HNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQ 313 Escherichia coli
P11604   237 LTPTILRDSQEYVSKKHNLP--HNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQ 314 Escherichia coli
O51401   236 LTPKVLKDGQDYVISKTGVNm-AKPVSYVFHGGSGSTIDEINEALSYGVVKMNIDTDTQWAAWEGVLNYYKKNESRLQGQ 314 Borrelia burgdorfer...
O06313   222 LRPDILAQGQQVAAAKLGLPadAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKV 301 Mycobacterium tuber...
AAB00930 242 LHPDLLGKQQAYVPEKLGGKd-KKPFFFVFHGGSGSSKEEYREAISNGVVKVNVDTDLQWSYLVGIRDYILNNIDYLRSQ 320 Neurospora crassa
P14540   236 LRPEILAEHQKYTREQVGCKe-EKPLFLVFHGGSGSTVQEFHTGIDNGVVKVNLDTDCQYAYLTGIRDYVLNKKDYIMSP 314 Saccharomyces cerev...
1B57_A   314 LGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 358 Escherichia coli
P11604   315 LGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 359 Escherichia coli
O51401   315 LGDGKDIDIPNKKFYDPRVWLREAEVSMKDRVKIACKNLNNINRN 359 Borrelia burgdorferi B31
O06313   302 DG-----EVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKS 341 Mycobacterium tuberculosis
AAB00930 321 VGNPEGPNKPNKKKYDPRVWIREGEKTMKARVEEGPQGPSNTTVT 365 Neurospora crassa
P14540   315 VGNPEGPEKPNKKFFDPRVWVREGEKTMGAKITKSLETFRTTNTL 359 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap