1COZ


Conserved Protein Domain Family
g3p_cytidyltrns

?
TIGR01518: g3p_cytidyltrns 
Click on image for an interactive view with Cn3D
glycerol-3-phosphate cytidylyltransferase
This model describes glycerol-3-phosphate cytidyltransferase, also called CDP-glycerol pyrophosphorylase. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most but not all species encoding proteins in this family are Gram-positive bacteria. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 130581
View PSSM: TIGR01518
Aligned: 4 rows
Threshold Bit Score: 208.951
Threshold Setting Gi: 499208093
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1COZ_A         4 VITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKKQDIID 83  Bacillus subtilis
WP_025192797   8 ILTYGTFDLLHYGHINLLKKAKQQGDYLIVGLSTDAFNLEKKKQSYFSYEKRKQLLEAIRYVDLVIPETSWKQKVSDIAE 87  Enterococcus fa...
P27623         4 VITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKKQDIID 83  Bacillus subtil...
WP_010905633   7 VLVAGTFDILHESHVNMLRNAKNLGSKLIVMLSTDEFNAGKGKKAFQDYDTRKYVLESIRYVDLVVPEQSWDDKSLYIDM 86  Lactococcus lactis
1COZ_A        84 HNIDVFVMGDDWEGKFDFLKDQC---EVVYLPRTEGISTTKIKEEI 126 Bacillus subtilis
WP_025192797  88 FKIDTLVMGDDWQGAFDFLEVETt-aKVLYLPRTPEVSTTQIKKEL 132 Enterococcus faecalis
P27623        84 HNIDVFVMGDDWEGKFDFLKDQC---EVVYLPRTEGISTTKIKEEI 126 Bacillus subtilis subsp. subtilis str. 168
WP_010905633  87 FDVDIFAMGDDWKGKFDFLKEEFpnlKIMYFPRGK-VSSSNIKKEM 131 Lactococcus lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap