2IM5,1VLP


Conserved Protein Domain Family
NAPRTase

?
TIGR01514: NAPRTase 
Click on image for an interactive view with Cn3D
nicotinate phosphoribosyltransferase
This model represents nicotinate phosphoribosyltransferase, the first enzyme in the salvage pathway of NAD biosynthesis from nicontinate (niacin). Members are primary proteobacterial but also include yeasts and Methanosarcina acetivorans. A related family, apparently non-overlapping in species distribution, is TIGR01513. Members of that family differ in substantially in sequence and have a long C-terminal extension missing from this family, but are proposed also to act as nicotinate phosphoribosyltransferase (see model TIGR01513). [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridine nucleotides]
Statistics
?
PSSM-Id: 130578
View PSSM: TIGR01514
Aligned: 6 rows
Threshold Bit Score: 558.22
Threshold Setting Gi: 52696213
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IM5_A         3 IIRSILDTDLYKFTTGYAYAKLFPRAYGEFRFIDRNRQg--FTEEFAELVRGEIRAMAALSLTRDEKEFLQReLPYLPPI 80  Porphyromonas g...
P39683         5 VIKSLLDTDMYKITMHAAVFTNFPDVTVTYKYTNRSSQl-tFNKEAINWLKEQFSYLGNLRFTEEEIEYLKQeIPYLPSA 83  Saccharomyces c...
WP_009344788  21 IIHSLLDTDLYKFTMLQVVLHQFPQTHSLYEFRCRNAStvyPLADIREDLEAELDALCQLRFTHDELGYLRS-LRFIKSD 99  Neisseria menin...
WP_001069589  10 IIRSLLDLDAYKINMMQAIHHFYPDVSVRYELIVRSEE---DASGLLDAIRQEIAHLGTLRFSDADIHYLTQhAPHLKAT 86  Vibrio cholerae
P18133         8 VLHSLLDTDAYKLHMQQAVFHHYYDVHVAAEFRCRGDD---LLGIYADAIREQVQAMQHLRLQDDEYQWLSA-LPFFKAD 83  Escherichia col...
1VLP_A        17 VIKSLLDTDXYKITXHAAVFTNFPDVTVTYKYTNRSSQl-tFNKEAINWLKEQFSYLGNLRFTEEEIEYLKQeIPYLPSA 95  baker's yeast
2IM5_A        81 YIDFLD--GFRFDPeE-VTVSi--DA---QG----HLDIRAQGLLYRVTLWETPILAVISELYYRFIGAEPDWKQVEEVT 148 Porphyromonas g...
P39683        84 YIKYISssNYKLHPeEqISFTseeIE---GKpthyKLKILVSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQA 160 Saccharomyces c...
WP_009344788 100 FVDYLE--LFQLQR-RfVEIGt--DD---KD----RLNIRIEGPMIQAMFFEIFILAIVNELYFRRLETPAVIEEGERRL 167 Neisseria menin...
WP_001069589  87 FLQSLR--YFHFVPqEqVEMGi--VKqggKQ----QLRISIRGSWRDTILYETLVMAIVSEVRSRQRWAEVPADLPLKVL 158 Vibrio cholerae
P18133        84 YLNWLR--EFRFNP-EqVTVS---ND---NG----KLDIRLSGPWREVILWEVPLLAVISEMVHRYRSPQADVAQALDTL 150 Escherichia col...
1VLP_A        96 YIKYISssNYKLHPeEqISFTseeIE---GKpthyKLKILVSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQA 172 baker's yeast
2IM5_A       149 RSK---------GELMREhrATFSIFGMRRRFSLEVEDRVTDILKQYAg-------eSLFGTSNVHLAHKHGLRVSGTHP 212 Porphyromonas g...
P39683       161 EKK---------AETLFDngIRFSEFGTRRRRSLKAQDLIMQGIMKAVngnpdrnksLLLGTSNILFAKKYGVKPIGTVA 231 Saccharomyces c...
WP_009344788 168 QAKaarlkeiaaAQNPDEppFLISDFGTRRRYKLAWQEHVIRTLLEAAp-------gIVRGTSNVFLAKKLGITPIGTMA 240 Neisseria menin...
WP_001069589 159 KTKldqlkaeieRRGINN--FSLTEMGTRRRFSSQVQRDVLACLKQEIp-------qWVLGTSNYHFAREFDLKPIGTIA 229 Vibrio cholerae
P18133       151 ESKlvdfsaltaGLDMSR--FHLMDFGTRRRFSREVQETIVKRLQQES---------WFVGTSNYDLARRLSLTPMGTQA 219 Escherichia col...
1VLP_A       173 EKK---------AETLFDngIRFSEFGTRRRRSLKAQDLIXQGIXKAVngnpdrnksLLLGTSNILFAKKYGVKPIGTVA 243 baker's yeast
2IM5_A       213 HEWIQFHGAIYg-YkMANYVAMEDWINVYDGD-LGTVLTDTYTTDVFMRNFSKKHAMLFTSLRHDSGDPEIFIEKAVRRY 290 Porphyromonas g...
P39683       232 HEWVMGVASISedYlHANKNAMDCWINTFGAKnAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISHHY 311 Saccharomyces c...
WP_009344788 241 HEFLQAFQALDvrLrNFQKAALESWVHEYRGD-LGVALTDVVGMDAFLRDFDLYFAKLFDGLRHDSGDPYVWGDKAYAHY 319 Neisseria menin...
WP_001069589 230 HEWFMGHQALVne-rDSQQVALERWLTAFDGM-LAIAPTDTLTIDAFLNDFNRHLANAYDGVRHDSGCPFRWGDKMIAHY 307 Vibrio cholerae
P18133       220 HEWFQAHQQISpdLaNSQRAALAAWLEEYPDQ-LGIALTDCITMDAFLRDFGVEFASRYQGLRHDSGDPVEWGEKAIAHY 298 Escherichia col...
1VLP_A       244 HEWVXGVASISedYlHANKNAXDCWINTFGAKnAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISHHY 323 baker's yeast
2IM5_A       291 EELRVDPK-IKYIIFSDSLTPQRAIEIQKLCAG-RIKASFGIGTNLTNDVgG--------GVEPLNIVMKLWKCKMTAkd 360 Porphyromonas g...
P39683       312 HDVLKLPKfSKIICYSDSLNVEKAITYSHAAKEnGMLATFGIGTNFTNDF-Rkkse-pqvKSEPLNIVIKLLEVNGNH-- 387 Saccharomyces c...
WP_009344788 320 QKLKIDSR-TKMLTFSDGLDIERSWALHQYFKD-RFKTGFGIGTNLTNDM-G---------HTPLNIVLKLVECNGQS-- 385 Neisseria menin...
WP_001069589 308 QQLGIDPT-TKLFIFSDGLDFDQALELCEYFAG-RVKISFGIGTFLTNDL-AnwrnaagvEYRPLSIVIKLAECQGRP-- 382 Vibrio cholerae
P18133       299 EKLGIDPQ-SKTLVFSDNLDLRKAVELYRHFSS-RVQLSFGIGTRLTCDI-P--------QVKPLNIVIKLVECNGKP-- 365 Escherichia col...
1VLP_A       324 HDVLKLPKfSKIICYSDSLNVEKAITYSHAAKEnGXLATFGIGTNFTNDF-Rkkse-pqvKSEPLNIVIKLLEVNGNH-- 399 baker's yeast
2IM5_A       361 dwhyCVKLSDVDGKHTGEPEEILLAMNTLGIKP 393 Porphyromonas gingivalis
P39683       388 ----AIKISDNLGKNMGDPATVKRVKEELGYTE 416 Saccharomyces cerevisiae S288c
WP_009344788 386 ----VAKLSDSPGKTMTNNSTFLAYLRQVFDVP 414 Neisseria meningitidis
WP_001069589 383 ----VAKISDQPEKAMCEDPIFLANLKRRFNIE 411 Vibrio cholerae
P18133       366 ----VAKLSDSPGKTICHDKAFVRALRKAFDLP 394 Escherichia coli K-12
1VLP_A       400 ----AIKISDNLGKNXGDPATVKRVKEELGYTE 428 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap