Conserved Protein Domain Family
ribC_arch

?
TIGR01506: ribC_arch 
riboflavin synthase
This archaeal protein catalyzes the same reaction, the final step in riboflavin biosynthesis, as bacterial riboflavin biosynthesis alpha chain. However, it is more similar in sequence to 6,7-dimethyl-8-ribityllumazine synthase, which catalyzes the previous reaction and which (in bacteria) is called the riboflavin synthase beta chain. [Biosynthesis of cofactors, prosthetic groups, and carriers, Riboflavin, FMN, and FAD]
Statistics
?
PSSM-Id: 130570
View PSSM: TIGR01506
Aligned: 3 rows
Threshold Bit Score: 225.54
Threshold Setting Gi: 9789768
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O26237   3 KVGICDTTFARYDMGGAAIDELKkHTAGIKIIRRTVPGIKDLPVACKKLIEEEGCEMVMALGMPGPEEKDKVCAHEASTG 82  Methanothermobacter t...
O28856   2 KIGIADTTFSRINMGKIAIDELR-KISSIPYERYTVPGIKDLPIAAKKLLEEKGCDIVITLGWVGGTQKDMLSYIVLSMG 80  Archaeoglobus fulgidu...
Q9YDC5   4 CVGVADTTFARVDMGSVAEEVLRrRLPGYRIVRHTVPGIKDLPGAAKRILS-MGCEGVITLGWVGRREADKLSYLAASVG 82  Aeropyrum pernix K1
O26237  83 LIQAQLMTNTHILEVFVHEDEEDDPEELKVLADNRAREHAQNLIMMLFKPDR-LTREAGMGLREGKPDAGPL 153 Methanothermobacter thermauto...
O28856  81 LVIVQLMTNKHVIDVTIHEDEAEDEKTLMMVAENRVREHVRNAVDLLVNPKR-LQKLAGTGQRQGYPDVGPI 151 Archaeoglobus fulgidus DSM 4304
Q9YDC5  83 LIMVEVLTGKIVIDVTVHEDEAEAPEELAAIAVDRARKHAENLAALIREGPEaLVKHAGMGLRQGYPDAGPI 154 Aeropyrum pernix K1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap