1YB4,1VPD


Conserved Protein Domain Family
tartro_sem_red

?
TIGR01505: tartro_sem_red 
Click on image for an interactive view with Cn3D
2-hydroxy-3-oxopropionate reductase
This model represents 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60), also called tartronate semialdehyde reductase. It follows glyoxylate carboligase and precedes glycerate kinase in D-glycerate pathway of glyoxylate degradation. The eventual product, 3-phosphoglycerate, is an intermediate of glycolysis and is readily metabolized. Tartronic semialdehyde, the substrate of this enzyme, may also come from other pathways, such as D-glucarate catabolism.
Statistics
?
PSSM-Id: 130569
View PSSM: TIGR01505
Aligned: 5 rows
Threshold Bit Score: 421.22
Threshold Setting Gi: 56554320
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YB4_A     5 KLGFIGLGIXGSPXAINLARAGHQLHVTTIGP-VADELLSLGAVNVETARQVTEFADIIFIXVPDTPQVEDVLFGEHGCA 83  Salmonella enterica...
CAB36613   6 KVAWIGLGIMGSPMSENLIKAGYQVTGFTLEQeKLDRLAAAGGGVAGSIAEAVRDADVVVTMVPASPQVEAIAYGPDGIL 85  Streptomyces coelic...
P77161     2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGp-VADELLSLGAVSVETARQVTEASDIIFIMVPDTPQVEEVLFGENGCT 80  Escherichia coli K-12
P23523     2 KVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPeAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGII 81  Escherichia coli
1VPD_A     7 KVGFIGLGIXGKPXSKNLLKAGYSLVVSDRNPeAIADVIAAGAETASTAKAIAEQCDVIITXLPNSPHVKEVALGENGII 86  Salmonella enterica...
1YB4_A    84 KTSLQGKTIVDXSSISPIETKRFAQRVNEXGADYLDAPVSGGEIGAREGTLSIXVGGEQKVFDRVKPLFDILGKNITLVG 163 Salmonella enterica...
CAB36613  86 ENAKSGALLVDMSSITPQTSVDLAKAAKDKGIRVLDAPVSGGEAGAIEAVLSIMVGGEQADFDEAKPLLEALGKTIVLCG 165 Streptomyces coelic...
P77161    81 KASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVG 160 Escherichia coli K-12
P23523    82 EGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTG 161 Escherichia coli
1VPD_A    87 EGAKPGTVLIDXSSIAPLASREISDALKAKGVEXLDAPVSGGEPKAIDGTLSVXVGGDKAIFDKYYDLXKAXAGSVVHTG 166 Salmonella enterica...
1YB4_A   164 GNGDGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALXGGFASSRILEVHGERXINRTFEPGFKIALHQKDLN 243 Salmonella enterica...
CAB36613 166 PHGSGQTVKAANQLIVAVNIQACAEAVVFLEKSGVDLKAALDVLNGGLAGSTVLTRKKDNFLGRDFKPGFRIDLHHKDMG 245 Streptomyces coelic...
P77161   161 GNGDGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLN 240 Escherichia coli K-12
P23523   162 EIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLA 241 Escherichia coli
1VPD_A   167 DIGAGNVTKLANQVIVALNIAAXSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPXVXDRNFKPGFRIDLHIKDLA 246 Salmonella enterica...
1YB4_A   244 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAXVQALELXANHKL 294 Salmonella enterica subsp. enterica serovar Typh...
CAB36613 246 IVTDAARNVGAALPVGAVVAQLVASLRAQGDGGLDHSALLRAVERLSGDQV 296 Streptomyces coelicolor A3(2)
P77161   241 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKL 291 Escherichia coli K-12
P23523   242 NALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEV 292 Escherichia coli
1VPD_A   247 NALDTSHGVGAQLPLTAAVXEXXQALRADGHGNDDHSALACYYEKLAKVEV 297 Salmonella enterica subsp. enterica serovar Typh...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap