1CCW


Conserved Protein Domain Family
MthylAspMut_E

?
TIGR01503: MthylAspMut_E 
Click on image for an interactive view with Cn3D
methylaspartate mutase, E subunit
This model represents the E (epsilon) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation. [Energy metabolism, Amino acids and amines, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130567
View PSSM: TIGR01503
Aligned: 5 rows
Threshold Bit Score: 812.136
Threshold Setting Gi: 499206162
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CCW_B         3 LKNKKWTDEEFHKQREEVLQQWPTGKEVD-LQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRY 81  Clostridium coc...
AAL93954       3 ITFKKIDKEDFLEIRKNFLENYKNLDDFD-LNTAIRFHKSLPDHKNFQKKIEQSVQDNKIMTQAHSKETLLEDLIKNLNT 81  Fusobacterium n...
P80077         3 LKNKKWTDEEFHKQREEVLQQWPTGKEVD-LQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRY 81  Clostridium coc...
WP_000423320   3 LRNKKLTHDEFMTERQQVLKTWETGKDVEnFEDGVKYQQTIPEHKRFSLALLKADKEGKTLSQPRAGVALMDEHIELLKT 82  Escherichia coli
WP_010903702   2 IEDKRLTDTELEAITDRITGDWVSRAAVD-FADAVAFHESLPPHKRFAAVLENAE---AVLCQPRAGVPRLDEHVELLQH 77  Halobacterium s...
1CCW_B        82 LQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEI 161 Clostridium coc...
AAL93954      82 FYRVGQADFLSIIIDSHTRENHYDNAKVILEDSIKSNKSLLNGFPLINYGTKLARKIINDVEVPLQIKHGSPDARLLVEV 161 Fusobacterium n...
P80077        82 LQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEI 161 Clostridium coc...
WP_000423320  83 LQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAGTSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEI 160 Escherichia coli
WP_010903702  78 LDEEGGADLLPTTIDSYTRDNAYEKAAEGLARSRETDSSELNGFPAVNHGVEGCREVVRRVDAPVQVRHGTPDARLLAAV 157 Halobacterium s...
1CCW_B       162 IHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAA 241 Clostridium coc...
AAL93954     162 ALLSGFSAFDGGGISHNIPFSKSISLKDSLENWKYVDRLVGIYEENGIKINREIFSPLTATLVPPAISNSIQILETLLAV 241 Fusobacterium n...
P80077       162 IHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAA 241 Clostridium coc...
WP_000423320 161 SMASGFTSYEGGGISYNIPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGLLAL 240 Escherichia coli
WP_010903702 158 TLAGGFQSFEGGPITYNLPYTSAYDLETTIEYWQYVDRLCGAYTERGVTINREPFGPLTGTLVPPSIAIAIVTIEGLLAA 237 Halobacterium s...
1CCW_B       242 EQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGAT 321 Clostridium coc...
AAL93954     242 EQGVKNISIGVAQYGNITQDIASLLALKEHIQFYLDTFSFKDINISTVFNQWIGGFPEEELKAYSLISYSTTIALFSKTN 321 Fusobacterium n...
P80077       242 EQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGAT 321 Clostridium coc...
WP_000423320 241 EQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFPEDESKAFAIISWGAAVAGMSGAT 320 Escherichia coli
WP_010903702 238 TQGVRSVTLGYGQVGNLVQDVAAVRAMAAIGAEYLPDS----VTVTTVLHQWMGGFPRDEARAHGVIGLAGATAALVEPT 313 Halobacterium s...
1CCW_B       322 KVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFET 401 Clostridium coc...
AAL93954     322 RIFVKNIDEYAKNSLGNTMINSLLLTKTILDIGNNQKINNYEEIIFEKEQIKKETAQIIAKIFSRCDGDLRKAIIEAFEY 401 Fusobacterium n...
P80077       322 KVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFET 401 Clostridium coc...
WP_000423320 321 KVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNEQKFPPCPAVELEIELIKSEVRAVLNKVFELGNGDIARGTVLAFEA 400 Escherichia coli
WP_010903702 314 KVITKSPQEAVGVPTAESNAAGLRTTDQVLRMLDEQSITLD-GVDREQALIERSVRSLLDAVYEAGDGDIARGTVRAFDA 392 Halobacterium s...
1CCW_B       402 GVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGR 481 Clostridium coc...
AAL93954     402 GVLDVPFAPSKYNLGKMMPARDSEGMIRYLDIGNLPFCPLIEEFHNKKIKERSMKENREINFQMTIDDIFAMSQGKLINK 481 Fusobacterium n...
P80077       402 GVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGR 481 Clostridium coc...
WP_000423320 401 GVLDVPFAPAACNAGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARCEGRQPTFQMVVDDINAVSHSKLIGR 480 Escherichia coli
WP_010903702 393 GTLDIPFPPSDAAAGDVLPARDDDGRVRLLKFGAVALDDETKRIHRARLDRRADTEGRELSFRMVADDVSAVSDGRLIGR 472 Halobacterium s...
1CCW_B       482 P 482 Clostridium cochlearium
AAL93954     482 K 482 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
P80077       482 P 482 Clostridium cochlearium
WP_000423320 481 P 481 Escherichia coli
WP_010903702 473 P 473 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap