1B1A


Conserved Protein Domain Family
MthylAspMutase

?
TIGR01501: MthylAspMutase 
Click on image for an interactive view with Cn3D
methylaspartate mutase, S subunit
This model represents the S (sigma) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation. [Energy metabolism, Amino acids and amines, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130565
View PSSM: TIGR01501
Aligned: 4 rows
Threshold Bit Score: 185.08
Threshold Setting Gi: 20138734
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1B1A_A   3 KKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLRQKCDEAG 82  Clostridium cochlearium
P80078   3 KKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLRQKCDEAG 82  Clostridium cochlearium
Q9HN21   5 DPTVVLGTIGSDAHAVGITLLDHALREAGFTVHNLGAQTAKTEFATAAADHDADAVLVSSLYGHAQQDCAGLHDQLAAAG 84  Halobacterium sp. NRC-1
P58620   3 KATLVIGVIGADCHAVGNKVLDRVFSNHDFRVINLGVMVSQDEYIDAAIETGADAIVVSSIYGHGDIDCLGMRERCIERG 82  Escherichia coli O157:H7
1B1A_A  83 LEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNI 136 Clostridium cochlearium
P80078  83 LEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNI 136 Clostridium cochlearium
Q9HN21  85 VDATTV-VGGNLAVGQTDFETVKQRFEEMGFDRVFSAQTGFEAVVDAVKTELDV 137 Halobacterium sp. NRC-1
P58620  83 LGDILLYVGGNLVVGKHDFADVETKFKEMGFDRVFAPSHDLEDVCQLMAHDINQ 136 Escherichia coli O157:H7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap