1XVI,1WZC,3ZTW


Conserved Protein Domain Family
HAD-SF-IIB-MPGP

?
TIGR01486: HAD-SF-IIB-MPGP 
Click on image for an interactive view with Cn3D
mannosyl-3-phosphoglycerate phosphatase family
This small group of proteins is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. Several members of this family from thermophiles (and from Dehalococcoides ethenogenes) are now known to act as mannosyl-3-phosphoglycerate (MPG) phosphatase. In these cases, the enzyme acts after MPG synthase to make the compatible solute mannosylglycerate. We propose that other mesophilic members of this family do not act as mannosyl-3-phosphoglycerate phosphatase. A member of this family is found in Escherichia coli, which appears to lack MPG synthase. Mannosylglycerate is imported in E. coli by phosphoenolpyruvate-dependent transporter (), but it appears the phosphorylation is not on the glycerate moiety, that the phosphorylated import is degraded by an alpha-mannosidase from an adjacent gene, and that E. coli would have no pathway to obtain MPG.
Statistics
?
PSSM-Id: 130550
View PSSM: TIGR01486
Aligned: 12 rows
Threshold Bit Score: 293.925
Threshold Setting Gi: 28950685
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XVI_A    11 LVFSDLDGTLLDSHSyDWQPAAPWLTRLREANVPVILCSSKTSAEMLYlqktLGLQg--LPLIAENGAVIQLAEQW---- 84  Escherichia coli K-12
AAO43098   2 IVFTDLDGTLLDERG-ELGPAREALERLRALGVPVVPVTAKTRKEVEA----LGLE---PPFIVENGGGLYLPRDW---- 69  Thermus thermophilu...
O58690     4 LIFLDIDKTLIPGYE--PDPAKPIIEELKDMGFEIIFNSSKTRAEQEYyrkeLEVE---TPFISENGSAIFIPKGY---- 74  Pyrococcus horikosh...
Q9YDM7     9 VIFTDLDNTLVGPGG-EAGEAGEVYLEALDLGYRVVPVTSKSIYEIVElwdsIGVPpgeRIALAESGGAIYGPRGS---- 83  Aeropyrum pernix K1
AAP99773  11 WIVTDIDGTLMD-HQyDFSPALSTIKWLQELGIPIIPCTSKTAAEVRAlrleLGIT---DPFIVENGGAIYGDELS---- 82  Prochlorococcus mar...
CAE19419   8 WVVSDVDGTLMD-HSyDLTPAKETIKLLQELSIPVILCTSKTAAEVKVirkeLNLT---DPYIVENGAAIHGETLK---- 79  Prochlorococcus mar...
CAE08949  10 WVVTDLDGTLMD-HHyDWAPAAAVLRSLQRAGVPVIPCTSKTAEEVERfraaAQLR---DPYIVENGGAIHGETAT---- 81  Synechococcus sp. W...
P76329     9 LVFSDLDGTLLDSHSyDWQPAAPWLTRLREANVPVILCSSKTSAEMLYlqktLGLQg--LPLIAENGAVIQLAEQW---- 82  Escherichia coli K-12
CAG75151   9 IIFSDLDGSLLDHETyRWDAAQRWLTRLANEAIPLIITTSKTAAEVEPlqqaLGLDd--YPYIAENGAIAVLPPTW---- 82  Pectobacterium atro...
AAP74553  10 VIFTDLDGTLLDLHTyDPGPAREAVARLQERGIPIVFCSSKTRAEQLSyrrqLGIR---DPFIVENGATIFIPRGY---- 82  Rhodothermus marinu...
1WZC_A     4 LIFLDIDKTLIP--GyEPDPAKPIIEELKDMGFEIIFNSSKTRAEQEYyrkeLEVE---TPFISENGSAIFIPKGY---- 74  Pyrococcus horikoshii
3ZTW_A     2 IVFTDLDGTLLDERG-ELGPAREALERLRALGVPVVPVTAKTRKEVEa----LGLE---PPFIVENGGGLYLPRDWpvra 73  Thermus thermophilu...
1XVI_A    85 -Qe-----IDG-------F---PRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEAS 148 Escherichia coli K-12
AAO43098  70 -Pvr--agRPK-------Gg-yRVVSLAWPYRKVRARLREAEALAGRPILGYGDLTAEAVARLTGLSREAARRAKAREYD 138 Thermus thermophilu...
O58690    75 -FpfdvkgKEV-------Gn-yIVIELGIRVEKIREELKKLENIYGLKY--YGNSTKEEIEKFTGMPPELVPLAMEREYS 143 Pyrococcus horikosh...
Q9YDM7    84 -LarptgfNSE-------Vg-lEYTALGKPLASIDALLDSLAETCGAVR--LSKADATEAQLITGLPRERAALAARREYL 152 Aeropyrum pernix K1
AAP99773  83 -Sn-----EE------------WELVLGKSYKYLRSKLELISLELGYKLIPLNDLSYQEINELTGLEGRGIELALDRKWS 144 Prochlorococcus mar...
CAE19419  80 -R------VN------------GEIILGEKYEILENILISISNEINYNLQPLNNISDQEATELTGLKGHSLDLMRDRHWS 140 Prochlorococcus mar...
CAE08949  82 -G------EP------------WQEALGPGWTVLKPRLQELSEQLSEPLRALDELTDAEGERLLGLSGELLQQAQRRRCS 142 Synechococcus sp. W...
P76329    83 -Qe-----IDG-------F---PRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEAS 146 Escherichia coli K-12
CAG75151  83 -Rt-----HPE-------Y---PRKRMGSGYSIIRTQLEQLHASG-FRFKGFGDMSCAEIAEVTGLSEQDARRAQQREAS 145 Pectobacterium atro...
AAP74553  83 -FtvpreaRPT-------ShglEVIELGRPAAEIRRALREIRKETGLSFRGYHEMTVEEVAELTGLPPEAARRAMTREYS 154 Rhodothermus marinu...
1WZC_A    75 -Fp-----FDVkgkevgnY---IVIELGIRVEKIREELKKLENIYGLKY--YGNSTKEEIEKFTGMPPELVPLAMEREYS 143 Pyrococcus horikoshii
3ZTW_A    74 gRp-----KGG-------Y---RVVSLAWPYRKVRARLREAEALAGRPILGYGDLTAEAVARLTGLSREAARRAKAREYD 138 Thermus thermophilu...
1XVI_A   149 VTLIWrdSDERMAQFTARLNELGLQFMQGARFWHVLdASAGKDQAANWIIATYQQLsGKRPTTLGLGDGPNDAPLLEVMD 228 Escherichia coli K-12
AAO43098 139 ETLVL--CPEEVEAVLEALEAVGLEWTHGGRFYHAA-KGADKGRAVARLRALWPDP-EEARFAVGLGDSLNDLPLFRAVD 214 Thermus thermophilu...
O58690   144 ETIFE----WSRDGWEEVLVEGGFKVTMGSRFYTVH-GNSDKGKAAKILLDFYKR--LGQIESYAVGDSYNDFPMFEVVD 216 Pyrococcus horikosh...
Q9YDM7   153 EVIWSrsQECLDTILSTALRYRELTYVHRAPRTVQIaAHRGKGMAIDAALQEPLLR-PCAKVVVTAGDSSHDIPIIERGM 231 Aeropyrum pernix K1
AAP99773 145 VPFLNp-KDSDRERITEIASSLCTSIYKGNRMSHLLgEGSHKGKAVIELKKFLNQP---NIKVVALGDSQNDLPLLEVAD 220 Prochlorococcus mar...
CAE19419 141 MPFLNp-PENKEEEINICCKRFGVEIFRGNRMSHMLsINSNKGKAINALKNYSNNP---NIKIIGLGDSPNDLPLLLNSD 216 Prochlorococcus mar...
CAE08949 143 VPFVPp-SVAIQPRLDALSAAQGLAVVRGNRMCHLLgAEVSKGNALAALKQRLHEP---DVKVLALGDSPNDLPLLEVAD 218 Synechococcus sp. W...
P76329   147 VTLIWrdSDERMAQFTARLNELGLQFMQGARFWHVLdASAGKDQAANWIIATYQQLsGKRPTTLGLGDGPNDAPLLEVMD 226 Escherichia coli K-12
CAG75151 146 EPLLWldDASRLPHFRQLLADVGLALTQGGRFYHVMgTQTSKGFTGNWIKTQYIEKyGTDVKTLGLGDGPNDLSLLCTVD 225 Pectobacterium atro...
AAP74553 155 ETIIVdfGPADWQRFNAALVAHGLVCFAGGRFHTVVgLGTDKGQAVHRLAELYRQQ-HGAILTVGLGDSPNDVPMLRAVD 233 Rhodothermus marinu...
1WZC_A   144 ETIF----EWSRDGWEEVLVEGGFKVTMGSRFYTVHg-NSDKGKAAKILLDFYK-R-LGQIESYAVGDSYNDFPMFEVVD 216 Pyrococcus horikoshii
3ZTW_A   139 ETLVL--CPEEVEAVLEALEAVGLEWTHGGRFYHAa-KGADKGRAVARLRALWPDP-EEARFAVGLGDSLNDLPLFRAVD 214 Thermus thermophilu...
1XVI_A   229 YAVIVKGLNregvhlHDe-DpaRVWRTQREGPEGWREGLDHFF 270 Escherichia coli K-12
AAO43098 215 LAVYVGRGD------PP--E--GVLATPAPGPEGFRYAVERYL 247 Thermus thermophilus HB27
O58690   217 KAFIVG----------------SLKHKKAQNVSSIIDVLEVIK 243 Pyrococcus horikoshii OT3
Q9YDM7   232 LAFRVDYNRdwsrlvKP-----IYMVIPYEAPKAWTMLIETVK 269 Aeropyrum pernix K1
AAP99773 221 IAIVIPSRNgpnkflKKgiDkgEFLLAPAPHSEGWALAIRDLL 263 Prochlorococcus marinus subsp. marinus str. CCMP1375
CAE19419 217 YKIVIPGPGgpnlklIEklNeySFTLATDPNGYGWKSEINKLI 259 Prochlorococcus marinus subsp. pastoris str. CCMP1986
CAE08949 219 LAVVVPGAEgphprlRLgvEsgRFELARAPHAEGWAEAVERLL 261 Synechococcus sp. WH 8102
P76329   227 YAVIVKGLNregvhlHDe-DpaRVWRTQREGPEGWREGLDHFF 268 Escherichia coli K-12
CAG75151 226 CAVLIKGKGnqivslPEs-YagEQYCTQASGPQGWSEGLDHFI 267 Pectobacterium atrosepticum SCRI1043
AAP74553 234 RPFLVQRPDgtwesvDV--P--GLVPIPAPGPEGWCMAVEQLL 272 Rhodothermus marinus DSM 4252
1WZC_A   217 KVFIVg----------------SLKHKKAQNVSSIIDVLEVIK 243 Pyrococcus horikoshii
3ZTW_A   215 LAVYVGRGD----------PpeGVLATPAPGPEGFRYAVERYL 247 Thermus thermophilus HB27
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap