1S2O


Conserved Protein Domain Family
SPP_plant-cyano

?
TIGR01485: SPP_plant-cyano 
Click on image for an interactive view with Cn3D
sucrose-6F-phosphate phosphohydrolase
This model describes the sucrose phosphate phosphohydrolase from plants and cyanobacteria (SPP). SPP is a member of the Class IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. SPP catalyzes the final step in the biosynthesis of sucrose, a critically important molecule for plants. Sucrose phosphate synthase (SPS), the prior step in the biosynthesis of sucrose, contains a domain which exhibits considerable similarity to SPP albeit without conservation of the catalytic residues. The catalytic machinery of the synthase resides in another domain. It seems likely that the phosphatase-like domain is involved in substrate binding, possibly binding both substrates in a "product-like" orientation prior to ligation by the synthase catalytic domain.
Statistics
?
PSSM-Id: 130549
View PSSM: TIGR01485
Aligned: 4 rows
Threshold Bit Score: 415.366
Threshold Setting Gi: 61679846
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S2O_A     3 QLLLISDLDNTWV----GDQQALEHLQEYLGDRRGNF--YLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHP-- 74  Synechocystis sp. P...
CAC87815   3 PFLFVTDLDDTLVyrttGDDSALPELNQLLKRHRQEYgtKIVYSTGRSPVLYKELQAQKNLLQPDALVLSVGTEIYLNg- 81  Nostoc punctiforme ...
AAG31074   9 RLMIVSDLDHTMVdhhdEENLSLLRFGALWESVYCEDs-LLVFSTGRSPTLYKELRKEKPMLTPDITIMSVGTEITYGe- 86  Zea mays
CAB71001   9 RLILVADLDCTLVdhddPENNDLLRFNALWEAHYRHDs-LLVYCTGRSFSSYSSLRKKRPLLTPDIAVTSVGSEIVYGgg 87  thale cress
1S2O_A    75 --EGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGK 152 Synechocystis sp. P...
CAC87815  82 -aDTPDSDWSEILSPGWEREVVLSITRKYRELVRQPDSEQRAFKVSFFLEQEASANVLPQLEAELQKSKLNVKLIYSSGI 160 Nostoc punctiforme ...
AAG31074  87 -aMVPDDGWEEYLNNKWDRNIVVAETVSFSELKLQPETEQRPHKVSFFVDKKNAQEVIKSVAERLDKCGLDAKIIYSGGQ 165 Zea mays
CAB71001  88 esTVSDVVWTARLDYKWNRDIVVEETLKFPKLEPQPDKSQEEHKVSFFVGREDAVEIMKVLPGILEERGVDVKLVYSNGY 167 thale cress
1S2O_A   153 DVDLLPQRSNKGNATQYLQQHLAME---PSQTLVCGDSGNDIGLFET-SARGVIVRNAQPELLHWYDQWGDS--RHYRAQ 226 Synechocystis sp. P...
CAC87815 161 DLDIVPHSSDKGQAMQFLRQKWKFA---AEQTVVCGDSGNDIALFAVgNERGIIVGNARKELLQWHNEHPAE--HRYLAS 235 Nostoc punctiforme ...
AAG31074 166 DLDILPQGAGKGQALAYLLEKLSSCgkpPNNTLVCGDSGNDAELFSIpGVHGVMVSNAQEELLQWYTENAKDnpKIIHSN 245 Zea mays
CAB71001 168 AFDVLPRGAGKQGALTYLLDKLDIEgkqPSNTLVCGDSGNDAELFNIsDVYGVMVSNSHEELLQWYEENAKDnpKIFHAS 247 thale cress
1S2O_A   227 SSHAGAILEAIAHFDFL 243 Synechocystis sp. PCC 6803
CAC87815 236 CFCAGGIIEGLNYFGLL 252 Nostoc punctiforme PCC 73102
AAG31074 246 ERCAAGIIQAIGHFKLG 262 Zea mays
CAB71001 248 ERCGAGMIEAIQRFNLG 264 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap