Conserved Protein Domain Family
ccpA

?
TIGR01481: ccpA 
catabolite control protein A
Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130546
View PSSM: TIGR01481
Aligned: 5 rows
Threshold Bit Score: 560.565
Threshold Setting Gi: 487767841
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC82367       7 TITIYDVAHEAGVSMATVSRVVNGNPNVKPATRKKVLDVIRRLGYRPNAVARGLASKRTTTVGVVIPDISNAFYAELTRG 86  Thermoactinomyc...
CAC99677       2 NVTIYDVAREANVSMATVSRVVNGNPNVKPVTRKKVLDVINQLGYRPNAVARGLASKRTTTVGVIIPDISNVFYAELARG 81  Listeria monocy...
CAC40822       5 TVTIYDVAAEAAVSMATVSRVVNGNPNVKPATAKKVLAVIERLDYRPNAVARGLASKRSTTVGVIIPDVTNIYFAALRPG 84  Lactobacillus p...
WP_000219066   2 TVTIYDVAREARVSMATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKTTTVGVIIPDISNIYYSQLARG 81  Staphylococcus ...
WP_001844918  16 TVTIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLASKKTTTVGVVIPNITNGYFSSLAKG 95  Streptococcus p...
AAC82367      87 IEDIATMYHYNIILSNSDLQKDRELQLIETLLEKQVDGLLFLGGEITEAHREIFSATPVPVVLAASRDEKKELPYVTIDR 166 Thermoactinomyc...
CAC99677      82 IEDIATMYKYNIILSNSDENEDKELQVLNTLLGKQVDGIIYMGERISEQLQEEFDRSPAPVVLAGAVDMENKFASVNIDY 161 Listeria monocy...
CAC40822      85 IDDIAMMYKYNIILTNSDDAGEQEVNVLNTLMGKQVDGVIFMGNYIDDKLRAEFKRAKAPVVLAGTVDPNNESPSVNIDY 164 Lactobacillus p...
WP_000219066  82 LEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGIIFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDF 161 Staphylococcus ...
WP_001844918  96 IDDIAEMYKYNIVLANSDEDNEKEVSVVNTLFSKQVDGIIYMGYHLTDKIRSEFSRSRTPIVLAGTVDVEHQLPSVNIDY 175 Streptococcus p...
AAC82367     167 IQASKEATLILGHEGHKHVGFIGGPLTDSVNGYPRYLGYKEALKEMDIAFEEDLIRLGDYRYRSGYKAMRELLESRPeiT 246 Thermoactinomyc...
CAC99677     162 KQATKEAVKRFVDNGHKQIAFVSGSLNEPVNREMKLAGYKEALEEAGISYQEDYIIEAKYNYNAGVKVWAELSALSKkpN 241 Listeria monocy...
CAC40822     165 AAAVEEVVTNLIARGHKKIALALGSLSQSINARIPTDGLQTGLNQGKIPFDDALVYEAGYSYDAGRKLQPVIADSGP--T 242 Lactobacillus p...
WP_000219066 162 TEAAKEITGELIEKGAKSFALVGGEHSKKAQ-EDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLP--D 238 Staphylococcus ...
WP_001844918 176 KQATIDAVS-YLAKENERIAFVSGPLVDDINGKVRLVGYKETLKKAGITYSEGLVFESKYSYDDGYALAERLISSNA--T 252 Streptococcus p...
AAC82367     247 AVFAASDEMAVGALHAALDMGRDVPNDLSVIGFENIPLASQVRPLLSTVGVPMYDIGAVAMRLLTKYMNEEQVETGQVYL 326 Thermoactinomyc...
CAC99677     242 AVVVADDELAIGILNAALDAGIKVPEDLEVMTSNNTKLTLMSRPQLSTIVQPLYDIGAVAMRLLTKLMTSEEVDEKTVIL 321 Listeria monocy...
CAC40822     243 AVFVGDDEMAAGLINASMESGINVPDDLEVVTSNDTIITQITRPAITSITQPLYDIGAVAMRMLTKLMNDKELDEKTVTL 322 Lactobacillus p...
WP_000219066 239 AILCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMRLLTKYMNDEKIEEPNVVL 318 Staphylococcus ...
WP_001844918 253 AAVVTGDELAAGVLNGLADKGVSVPEDFEIITSDDSQISRFTRPNLTTIAQPLYDLGAISMRMLTKIMHKEELEEREVLL 332 Streptococcus p...
AAC82367     327 PYHIQLRESTR 337 Thermoactinomyces sp. E79
CAC99677     322 PHSEKLRGTTK 332 Listeria monocytogenes EGD-e
CAC40822     323 PYGIVRRGSTK 333 Lactobacillus plantarum
WP_000219066 319 PHRIEYRGTTK 329 Staphylococcus aureus
WP_001844918 333 PHGLTERSSTR 343 Streptococcus pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap