Conserved Protein Domain Family
STEVOR

?
TIGR01478: STEVOR 
variant surface antigen, stevor family
This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Statistics
?
PSSM-Id: 130543
View PSSM: TIGR01478
Aligned: 5 rows
Threshold Bit Score: 376.114
Threshold Setting Gi: 4138985
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD03650       1 MLLFLLLFNALLLSQNVNCRNNNYNIRFTQTITQQTSTKSRHLAEIERPKNPHYHNDPELKEIIDKLNEEAIKKYQKTHN 80  malaria parasit...
AAC71980       8 MLVMSILLIVLFLSYNVNNHNKKYNVGYIQNNRQMIMMKSRRLAEIQLPKCPHYNNDPELKKIIDKLNEERIKKYIETNN 87  Plasmodium falc...
AAD03649       8 MLLFTFLINTLLLPHYENYLNNDYNVSFIQNNTKRTTIKSRLLAQTQI-HNPHYHNDPELKEIIDKMNEEAIKKYQQTHD 86  malaria parasit...
AAD03651       8 MLLLTFLISTLILPHNI----------YNQNNKRGTTKISRLLAQTQN-RNPHYHNDAELKEIIDKLNKEAIQKYQETHD 76  malaria parasit...
XP_001351339   1 MLLFAFLFNAFLLSQRVKCINKIGNISLIKNNTQSISTKSRYLAEIERPNNPHYYNDPELKEIIDKLNKEAIKKYQKNHD 80  Plasmodium falc...
AAD03650      81 PYEQLQDLVEKKATKTRGGYGAEPMSTIEKELLKKYEEMFGDESHIMLKSGMYTNE-------GNKSCECSYKK----KS 149 malaria parasit...
AAC71980      88 SFEELHGLLVKERTKSLYENGMKKSSNMEKELLKKYDDSIRDEHNVISKSGIYTSDyr---klYDKSCDYQNQKilrdEL 164 Plasmodium falc...
AAD03649      87 PYEQLKEVVEKNGTKYSGGNDAEPISTLEKELLETYEEIFGNESD-MLKSGMSPNvd-----eKSSTFECTDINg---VK 157 malaria parasit...
AAD03651      77 PYEQLQELVEQNRTINTDKHGTEPMSTIEKELLETHQEMFGEENHIILKSGMYKNDddr--tdKSSTCESTDTNn---TE 151 malaria parasit...
XP_001351339  81 PYEQLKEVVEKNQTKVTGGNDAEPMSTLEKDLLEIYEKLFGDKSHIMIKSNIYINQddksndkNDKSCECANYKky-nQL 159 Plasmodium falc...
AAD03650     150 SSSNKVHENYLNNLKEGCIAGVGTCAFSSALLGKFGIAAGATAAYQAAIGSLPVLAPYITSNTI-GVNFFFLSSLETAIK 228 malaria parasit...
AAC71980     165 ASCCKVHDNYLDNLKKGCFGGVGICTLCSLLVSNIGIGYAVTAAKEVITGLYSLDIANKFTKALaGIYFFFSSSIENAGV 244 Plasmodium falc...
AAD03649     158 LAKTKGRDKYLKHLKGRCTRGIYFCSLGSVILTYIGTTAAKGAAI-STAGAGS---K-NCIYAIsIFHMLNHKS-MSSAL 231 malaria parasit...
AAD03651     152 LAKTKGKDKYLKHLKKRCTRGICSCSVLSAFLTMLGLAFAKKAAL-VPFASYGK--TSTCSSVLtLTNMINFVTLESILK 228 malaria parasit...
XP_001351339 160 LSSYSVDDAYLHNLKSGCVACVGTSALSSIITGLYGISAASTAAIEAIKTTSSATIITKLTKSLfGINFFSQTSIESAYI 239 Plasmodium falc...
AAD03650     229 TGAptLSHlmgsfNTFESAVTAGTSTFFPYGMAIVVLIALTIIVIILYVWLRKKRKKLMESRMK 292 malaria parasite P. falciparum
AAC71980     245 SGVt-IFY-----WDSMRMASIASSTINPYGIAALVLIVLVVVLIVLYIWLYRRRKKSWKHECK 302 Plasmodium falciparum 3D7
AAD03649     232 TALg-TVGca--aDYASGATSASA-IFLPCGIAALVLLILTVLLIILYIWLYRRRKRSWKHECK 291 malaria parasite P. falciparum
AAD03651     229 ATTg-CAVga--sDVALPAATSANAIFGPCGIAALVLLILAVVLVILYIWLYKRRKNSWKHECK 289 malaria parasite P. falciparum
XP_001351339 240 TAG--ITS-----VEGELYAGLVTSTFLPYGIVAIVLILVIVALIMLYIWFYRRRKSSWKYAYK 296 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap