Conserved Protein Domain Family
chlor_syn_BchG

?
TIGR01476: chlor_syn_BchG 
bacteriochlorophyll/chlorophyll synthetase
This model describes a subfamily of a large family of polyprenyltransferases (pfam01040) that also includes 4-hydroxybenzoate octaprenyltransferase and protoheme IX farnesyltransferase (heme O synthase). Members of this family are found exclusively in photosynthetic organisms, including a single copy in Arabidopsis thaliana. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 130541
View PSSM: TIGR01476
Aligned: 4 rows
Threshold Bit Score: 408.012
Threshold Setting Gi: 13878356
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9Z5D6        16 RALLELIQPITWFPPIWAYLCGTVSVGIWPG------EKWPLVLLGMVLAGPLVCGMSQAANNWCDRHVDAVNEPDRPIP 89  Rhodobacter sph...
P33326        30 VRSIQLMKPVTWFAPTWAFMCGAIASGALGWn-----ESIGRLLLGMFMAGPILCGLSQVVNDYADREVDAINEPHRLIP 104 Chloroflexus au...
CAA83969      15 RAHIELADPVTWISPVLVCFCGALASGYERGfdwtrpDHWWLMLLGALMTGPLGTGFSQSINDYFDRDLDAINDPQRPIP 94  Chloroflexus au...
WP_010873507  32 KIRLQLMKPITWIPLIWGVVCGAASSGGYIWs----vEDFLKALTCMLLSGPLMTGYTQTLNDFYDRDIDAINEPYRPIP 107 Synechocystis s...
Q9Z5D6        90 SGRIPGRWGLYIALLMTVLSLAVGWMLGPWG-------FGATVFGVLAAWAYSVEPIRLKRSGWWGPGLVALCYEGLPWF 162 Rhodobacter sph...
P33326       105 SGQVSLRHVYILTAVLTWIGASIALFLGRQV-------AFFVALGLVFALAYSLRPIRGKRNGWIGNALVAISYEGLAWM 177 Chloroflexus au...
CAA83969      95 AGIISLNEARWNWIVLGAATLLVSLVFGNPLi------VLFAVVGIVLSVIYSMPPIKLKKHFWLGPPAVGLGYVSMSWM 168 Chloroflexus au...
WP_010873507 108 SGAISVPQVVTQILILLVAGIGVAYGLDVWAqhdfpimMVLTLGGAFVAYIYSAPPLKLKQNGWLGNYALGASYIALPWW 187 Synechocystis s...
Q9Z5D6       163 TGAAVLSAgaPSFFIVTVALLYAFGAHGIMTLNDFKALEGDRQHGVRSLPVMLGPEVAAKLACTVMAMAQILVITLLVIW 242 Rhodobacter sph...
P33326       178 AGHAAFAP--LTGESVTIALLYSLGAHGIMTVNDFKSIRGDTIMGIRSIPVQYGKVMAARMVVTTMGVAQIAVIGLLFHW 255 Chloroflexus au...
CAA83969     169 AGHLIFAP--LTWQSVVVALINGGLAAGLLFLNDIKSVEGDRKLGLQSLTVAIGVKRTLIVAYVTINSFEAMLMILALIW 246 Chloroflexus au...
WP_010873507 188 AGHALFGT--LNPTIMVLTLIYSLAGLGIAVVNDFKSVEGDRQLGLKSLPVMFGIGTAAWICVIMIDVFQAGIAGYLIYV 265 Synechocystis s...
Q9Z5D6       243 GKPIHAGIITALLVAQLFAMRV-LLRDPAGKCPWYNGTGVTLYVLGMMVAAFAIR 296 Rhodobacter sphaeroides 2.4.1
P33326       256 GHPVAATVVAILLAAQSIPNAR-FIRDPENNEVFFNATAIMLYVWGMLAAAIGLA 309 Chloroflexus aurantiacus J-10-fl
CAA83969     247 GQYWVAAFMFLALVAPIYNQIKlYQEPTQQNYVRYLLASNPFVALIQIISGFLVG 301 Chloroflexus aurantiacus J-10-fl
WP_010873507 266 HQQLYATIVLLLLIPQITFQDMyFLRNPLENDVKYQASAQPFLVFGMLATGLALG 320 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap