Conserved Protein Domain Family
ubiA_proteo

?
TIGR01474: ubiA_proteo 
4-hydroxybenzoate polyprenyl transferase, proteobacterial
This model represents a family of integral membrane proteins that condenses para-hydroxybenzoate with any of several polyprenyldiphosphates. Heterologous expression studies suggest that for, many but not all members, the activity seen (e.g. octaprenyltransferase in E. coli) reflects available host isoprenyl pools rather than enzyme specificity. A fairly deep split by both clustering (UPGMA) and phylogenetics (NJ tree) separates this group (mostly Proteobacterial and mitochondrial), with several characterized members, from another group (mostly archaeal and Gram-positive bacterial) lacking characterized members. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 130539
View PSSM: TIGR01474
Aligned: 11 rows
Threshold Bit Score: 329.664
Threshold Setting Gi: 490734036
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O52366        10 WHAYSRLMRIDRPIGSLLLLWPTYWALWIAAQ---------SIP---------SLHILIVFTAGVFLMRAAGCVINDFAD 71  Providencia stu...
AAH08804      71 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEp-------gCFP---------DWYMLSLFGTGAILMRGAGCTINDMWD 134 human
P32378        80 WIPYAELMRLEKPVGTWLLYLPCSWSILMGAMmqg----atLSA---------TAGMLGIFGVGALVMRGAGCTINDFLD 146 Saccharomyces c...
Q10252        65 WQYYAEISRAGSPTGTYLLYSPCTWSILMAAYayd----ssLVN---------VTKMLALFGVGSFLMRSAGCVINDLWD 131 Schizosaccharom...
WP_010892617  54 LDPYWKLARGDRPVGFLLLLWPTWWALWLAAg---------GVP---------PWWTLCVFTTGIWLTRSAGCVINDYTD 115 Xylella fastidiosa
WP_010968873  27 LWPYAQLARWDRPIGWQLLLLPCLWSAAMAAGaaaslgsfsAGR---------FLFHIFLFTVGAIAMRGAGCTYNDIVD 97  Sinorhizobium m...
WP_010921250  41 LRPWLKLGRFDRPVGIWLLMLPGWQGIALAAAeq------gRWP---------NPLLLLAVFVGAALMRAAGCAFNDIVD 105 Caulobacter vib...
ETA71888      32 VWPYAQLARWDRPIGWQLLLWPCWWSAALAASa-------yPRPgdpllsllpAPLYLVLFLVGAIAMRGAGCTYNDIVD 104 Mesorhizobium l...
WP_002249830  15 LDVYLRLMRADKPIGTLLLLWPTYWALWLASD---------GIP---------DLAVLAAFTIGTFLMRSAGCVINDFAD 76  Neisseria menin...
WP_010874074  12 WLTIIYLLRWHKPAGRLILMIPALWAVCLAAQ---------GLP---------PLPLLGTIALGTLATSGLGCVVNDLWD 73  Synechocystis s...
WP_004596372   7 LLIIFKLMRADKPVAYLLVFFPALFGLLLANPs--------NME---------LAYLLPLFIFGSITARSSGCIINDIFD 69  Rickettsia prow...
O52366        72 RHFDGHVERTKHRPLPSGDVTEKEAKILFASLVGLSFLLVLTLNSMTIWLSVAGLALAWIYPFVKRVSHLLQVVLGAAFG 151 Providencia stu...
AAH08804     135 QDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIALGAGSLLLVITYPLMKRISYWPQLALGLTFN 214 human
P32378       147 RKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLGLASLPIVFTYPLFKRFTYYPQAALSACFN 226 Saccharomyces c...
Q10252       132 RELDAKVERSKSRPLASGKLSVRQAISLLSVQLTASLGILLQLNPYTIKLGVASLVPVCIYPAMKRITYYPQVVLGLTFG 211 Schizosaccharom...
WP_010892617 116 RWLDPHVERTRIRPLVTGAVSPRNALLMFATLMLIAFGLVLTMNQLTVLLSVVGLFLAMTYPYLKRYTYLPQVYLGLAFG 195 Xylella fastidiosa
WP_010968873  98 HDIDMEVARTRSRPLPSGRVTRFQAKAFMLLQALVGLVVLLQFNGFTIFLGFLSLALVAIYPFAKRFTDWPQFFLGLAFS 177 Sinorhizobium m...
WP_010921250 106 RDFDAQVARTAMRPIPAGLISVKQAWLFVVGCCGVSFLILICLGWTAILLGVLSLALVAAYPFMKRITWWPQAWLGLTFN 185 Caulobacter vib...
ETA71888     105 ENIDNQVDRTRSRPLPSGQTTRRRAWLFLVLQALVGLAVLLQFNSFAILLGICSLAIVAIYPFMKRITNWPQLFLGLAFS 184 Mesorhizobium l...
WP_002249830  77 RDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIPLNHLTWLMSLPALFLALTYPFTKRFFPIPQLYLGLAFS 156 Neisseria menin...
WP_010874074  74 RDIDPQVERTKQRPLAARALSVQVGIGVALVALLCAAGLAFYLTPLSFWLCVAAVPVIVAYPGAKRVFPVPQLVLSIAWG 153 Synechocystis s...
WP_004596372  70 RKFDKYVERTKKRPLASGAVSVFYAIFILLILSIISLSILLLLNKTAIYTGFFAVIMIILYPLMKRITYFPQIFLGFTFK 149 Rickettsia prow...
O52366       152 WSIPMGFSAVSE----SLPLVCWvLFLVNILWSVIYDTQYAMVDRNDDLKIGVKSTAILFGQYD-KLIIGILQIVMIVLL 226 Providencia stu...
AAH08804     215 WGALLGWSAIKGs--cDPSVCLP-LYFSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENT-KPWLSGFSVAMLGAL 290 human
P32378       227 WGALLGFPAMGv---mSWPTMIP-LYLSSYLWCMTYDTIYAHQDKKFDIKAGIKSTALAWGPRT-KSIMKAMSASQIALL 301 Saccharomyces c...
Q10252       212 YGAVMGWPALAGeacmNWSVVAP-LYLSTISWIVLYDTIYAHQDKRDDVKANIYSTALRFGDNT-KPVLCGLAALQIATL 289 Schizosaccharom...
WP_010892617 196 WGIPMAFAAIQG----KVPTQAWlLYVANILWTTAYDTWCAMVDRDDDIKMGAKSTAILFADLD-LTVQGVLYTLMLFTL 270 Xylella fastidiosa
WP_010968873 178 WGAIMGWTAEFG----SLSLAAIsLYAAAIAWTIGYDTIYAYQDREDDELIGVRSTARRFGDNP-QPWLIGLYGIAVFLM 252 Sinorhizobium m...
WP_010921250 186 WGALLGYAAATG----HLSWSAAlLYASGIFWTLGYDTIYAIQDIEDDALAGIKSSTRRLGQHV-QIGVAGFYLVSFILL 260 Caulobacter vib...
ETA71888     185 WGALMGWAVEFG----DLDGPAImLYIGSILWVIGYDTIYAHQDKEDDAIVGVRSTARLFGDNT-KSWLAGLYGGTLICF 259 Mesorhizobium l...
WP_002249830 157 FGIPMAFAAVAG----NVLPQAWiLFAANVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYD-IAAVMLCHGGFTLLM 231 Neisseria menin...
WP_010874074 154 FAVLISWSAVTG----DLTDATWvLWGATVFWTLGFDTVYAMADREDDRRIGVNSSALFFGQYV-GEAVGIFFALTIGCL 228 Synechocystis s...
WP_004596372 150 LGVLVAYGAVQD----KLDTEAIiMYLACCFWAIGYDTIYGYMDIKDDKKIGVKSLSIYLENKNpKFWLYICYIGFILLF 225 Rickettsia prow...
O52366       227 VLVGSLAD--LGAVYY-IALSLSALLFIYQQKLMVDRERAPCF--KAFLNNNYVGLILFIGIFLSYL 288 Providencia stuartii
AAH08804     291 SLVGVNSG--QTAPYY-AALGAVGAHLTHQIYTLDIHRPEDCW--NKFISNRTLGLIVFLGIVLGNL 352 human
P32378       302 AVAGLNSGllWGPGFI-GGLGVFAYRLFSMIKKVDLDNPKNCW--KYFNANINTGLYFTYALAVDYI 365 Saccharomyces cerevisiae S288c
Q10252       290 ATAGIMNG--QGPVFYtLGVAGAAYRLSSMIYKVDLDDPKDCF--RWFKRNSNTGYLVAAAIALDWL 352 Schizosaccharomyces pombe 972h-
WP_010892617 271 CLVGLRAT--LSHTYW-ISLIAAVALIGYQFIIARRREPTACF--RAFMHNNWVGMTIFAGIALATT 332 Xylella fastidiosa
WP_010968873 253 LFAFLAAG--AGFFAY-VGLLVAAVMLAYQIVVLNIHDPLQCL--ALFKFNGVVGLIIFAGLVLSLL 314 Sinorhizobium meliloti
WP_010921250 261 VIAGWMGD--IGPLFL-PLAALFALHLSRQAAAVRIEDGPGAL--KLFKSNALAGLLVFAGLVAGLW 322 Caulobacter vibrioides
ETA71888     260 AIAFASAQ--APVVAL-AGLIAAGAHMARQIAVLDINDPDQCL--RLFRSNNQVGWLIFLGLIGGAL 321 Mesorhizobium loti R7A
WP_002249830 232 AVLGAVIG--AAWAYW-TAIPIVLLLQYRQYAAIKSRVRQICF--ETFLANNRIGWVWFTAIFAHTF 293 Neisseria meningitidis
WP_010874074 229 FYLGMILM--LNPLYW-LSLAIAIVGWVIQYIQLSAPTPEPKLygQIFGQNVIIGFVLLAGMLLGWL 292 Synechocystis sp. PCC 6803
WP_004596372 226 ILATKIAN--FN-IDY-LPVLAALILLILQIATLDIKNPVNCI--KRFSANNYVGVLLIMA----FC 282 Rickettsia prowazekii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap