Conserved Protein Domain Family
cysG_Nterm

?
TIGR01470: cysG_Nterm 
siroheme synthase, N-terminal domain
This model represents a subfamily of CysG N-terminal region-related sequences. All sequences in the seed alignment for this model are N-terminal regions of known or predicted siroheme synthases. The C-terminal region of each is uroporphyrin-III C-methyltransferase (EC 2.1.1.107), which catalyzes the first step committed to the biosynthesis of either siroheme or cobalamin (vitamin B12) rather than protoheme (heme). The region represented by this model completes the process of oxidation and iron insertion to yield siroheme. Siroheme is a cofactor for nitrite and sulfite reductases, so siroheme synthase is CysG of cysteine biosynthesis in some organisms. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 130536
View PSSM: TIGR01470
Aligned: 6 rows
Threshold Bit Score: 270.043
Threshold Setting Gi: 9105734
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK89520      20 LPVFWGLEGKRVVLTGGSDGAAWKAELLLACGAQLDLYCEESglsESLATLVAKSPMLTWHDRCWD-ADIFKGAELALAD 98  Agrobacterium t...
AAF83642       7 FPLFANLHDRAVLVVGGGKVAERKTEALLKVGALPIIGAPSL---TASLQHWAETGRITWRQGTFEnSWLQEDIWLVIAA 83  Xylella fastidi...
WP_009874378   4 LPIFIDLKSKNVLVIGAGEVGLNKIRILLRAKAKVNVIAKEL---CSEVKLLLRDQKINWLSKNFD-LIYLNKIFLVVSA 79  Buchnera aphidi...
WP_014602797   4 LPLFHSLQGRLALVVGGGEVALRKARLLADAGARLRVVAPQI---HIELRHLVEQGGGELLERDYQ-DGDQPGCALIIAA 79  Pseudomonas aer...
CAA71251       4 FPIFANLAGRPVLVVGGGAVAARKISLLLKAGAEVRVAAKHL---NAELSALAAENKILWLAEEFR-AEHIRTVFLIIAA 79  Neisseria menin...
WP_010911516  11 FPVFVRVEGEAVAIVGGGDEALAKARLIGQSSAVLRIIAENA---EPELLAFIGQSGASHVAAAYD-ASQLEGAVMVFAA 86  Mesorhizobium loti
AAK89520      99 CEAEEEAGRFYHAARAAGVPVNVIDKPEFCQFQFGSIVNRSPVVVSISTDGAAPILAQAIRRRIETLLPLSLKDWGALAQ 178 Agrobacterium t...
AAF83642      84 TDQPEVNHAAARAAHAQRLFVNVVDDIALSNVQVPAVVERGPLRIAISSGGGAPMVARYLRQQLESLIDDSWGRLTTLFA 163 Xylella fastidi...
WP_009874378  80 TNDIKLNQYIFKKCNERCVLVNIVDDKLKCSFIFPSIIDRSPLIVAISSGGTAPVLLRLLREKIEAILPNKLGDVAKIAG 159 Buchnera aphidi...
WP_014602797  80 TDDEPLNAEVSRAANARGIPVNVVDAPALCSVIFPAIVDRSPLVVAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLAS 159 Pseudomonas aer...
CAA71251      80 SSDQALNRRVFHLAESCQKPVNVVDDRDHCSFIFPSVIDRNPVQIAVSSSGSAPVLARLLRERLEALLPPSLGDMAEISG 159 Neisseria menin...
WP_010911516  87 SGDEALDRRVAADARELGIPVNAVDRPELCDFFTPALVNRAPVAIAIGTEGAGPVLAQMLRGRIDQMLSPSLGSLATLAA 166 Mesorhizobium loti
AAK89520     179 TIRERVNLRLAPGAARRSFWEKFVDRAFTERLDEGSEERLLKDVATRTG 227 Agrobacterium tumefaciens str. C58
AAF83642     164 QRRDTIRARYPNIEARRRFFETQLTGPLQRLLRKQRHAEAEAVLEAALA 212 Xylella fastidiosa 9a5c
WP_009874378 160 KWRLAIKKHFSNFLERRKFWEKLFHSIFVEHILNGNKEQAINVLKKNMN 208 Buchnera aphidicola
WP_014602797 160 RFRHRVKELLPDLQQRRVFWENLFQGEIAERVLAGRPAEAERLLEEHLA 208 Pseudomonas aeruginosa
CAA71251     160 RWRDAVKGKLKSVTERRRFWEKQFNGRFAALVKNRQNTLAERELAGQLE 208 Neisseria meningitidis
WP_010911516 167 TLRGAAEKLLPKGNARRRFWNSFFEGAPAHAVEAGQLSQAHDAAVDLLL 215 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap