Conserved Protein Domain Family
HAD-SF-IIA-hyp4

?
TIGR01459: HAD-SF-IIA-hyp4 
HAD-superfamily class IIA hydrolase, TIGR01459
This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all gram negative and primarily alpha proteobacteria. Only one sequence hase been annotated as other than "hypothetical." That one, from Brucella, is annotated as related to NagD, but only by sequence similarity and should be treated with some skepticism. (See comments for Class IIA subfamily model)
Statistics
?
PSSM-Id: 130526
View PSSM: TIGR01459
Aligned: 3 rows
Threshold Bit Score: 369.221
Threshold Setting Gi: 571155165
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010911810  12 IGPLAERYQVFLLDQFGVLHDGQAPYPGAVEALSALKRAGKtVVLISNSGKRARPNEVRLLKLGFAAgSWDHFVSSGEVA 91  Mesorhizobium loti
WP_004597898   9 IFDVINDYDVFLFDLWGVIIEGNHTYPGVVQNINKIIAQKK-VYFVTNAPRNIFSLHKTIKSWGINA-LPEMIISSGEIA 86  Rickettsia prow...
CDH69416      82 LEALCADYDGFLLDLWGVVMDGTEAFPGALAWLARRHAEGRpVWFLSNSSSSVAEMSAGLERLGIRRdWFAGITTSG--- 158 Pseudomonas aer...
WP_010911810  92 WRSFNDMAASGKLRPGTKCLLISRDNDRTAIEGLPFVLAEAGEDAELVLISASEGDRYDLDHYRELLAPA-AARQVPCFC 170 Mesorhizobium loti
WP_004597898  87 VQMILESKKRFDITNPIIYHLGHLENDIINLMQCYTTDDINKANISLITIYRDENEKLDLNEFDELFKII-VQRKIINIC 165 Rickettsia prow...
CDH69416     159 QLTIDALLQTAEYRRGGIYLAGVGLAQQSWPAEIRERFVEDIAQAALIVGVGS----FPQDELEQRFAPLrGATDLPFLC 234 Pseudomonas aer...
WP_010911810 171 TNPDRIMLTAVGPRFGAGEIADLYESLGGSVIRVGKPYPAIFDAALALAGEPERGSVVCVGDSIEHDIAGGNGVGIATAL 250 Mesorhizobium loti
WP_004597898 166 ANPDLGINQHGIYRYCSGYYAEKIKQLGGKVIYSGKPYEEIYHKILKECSNIPKNRMLMIGDTFYTDILAANRLGFDSAL 245 Rickettsia prow...
CDH69416     235 ANPDRVVVSGGRTVYGAGMLAELFSEEGGQVSWYGKPDPAAFRIAQRQLEARGARHILFVGDSLVTDVPGALAARIDTLW 314 Pseudomonas aer...
WP_010911810 251 VLG 253 Mesorhizobium loti
WP_004597898 246 VLT 248 Rickettsia prowazekii
CDH69416     315 LGA 317 Pseudomonas aeruginosa MH38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap