3HLT,2X4D


Conserved Protein Domain Family
HAD-SF-IIA-hyp3

?
TIGR01458: HAD-SF-IIA-hyp3 
Click on image for an interactive view with Cn3D
HAD-superfamily subfamily IIA hydrolase, TIGR01458
This hypothetical equivalog is a member of the IIA subfamily (TIGR01460) of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. One sequence (GP|10716807) has been annotated as a "phospholysine phosphohistidine inorganic pyrophosphatase," probably in reference to studies on similarly described (but unsequenced) enzymes from bovine and rat tissues. However, the supporting information for this annotation has never been published. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 162372
View PSSM: TIGR01458
Aligned: 5 rows
Threshold Bit Score: 436.601
Threshold Setting Gi: 12052886
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3HLT_A     7 LKAVLVDLSGTLHIEDA-----AVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARS 81  human
CAB66616   7 LKAVLVDLSGTLHIEDA-----AVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARS 81  human
CAB07315   7 VNGFLLDITGVLYNSIYksdgvAVPKSAEAVNFLYQHS-KVKFLSNAKGNSNRNVARRLQRLGINVREEDVITPAPVVAQ 85  Caenorhabditis elegans
BAB16411  11 VRGVLLDISGVLYDSGAgg-gtAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQ 89  human
2X4D_A    12 VRGVLLDISGVLYDSGAgg-gtAIAGSVEAVARLKRSRLKVRFCTNESAASRAELVGQLQRLGFDISEQEVTAPAPAACQ 90  human
3HLT_A    82 LLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAP--LIAIHKARYYKRKDGLALGP 159 human
CAB66616  82 LLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAP--LIAIHKARYYKRKDGLALGP 159 human
CAB07315  86 YCRENKLRPHLFVRDDVLEYFDGIDTSSPNCVVMGEVEEGFSFDRINRAFRILIDMPKplLITMGNGKFFQRVDGPCIDV 165 Caenorhabditis elegans
BAB16411  90 ILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKpvLISLGKGRYYKETSGLMLDV 169 human
2X4D_A    91 ILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKpvLISLGKGRYYAATSGLMLDV 170 human
3HLT_A   160 GPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPP 239 human
CAB66616 160 GPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPP 239 human
CAB07315 166 GAFAAALKFSTNCEVLNIGKPSRFYFEQGMNALGMKPEEIVMVGDDLMSDVGGAQACGMRGVQVRTGKWRP-DFEKMPVT 244 Caenorhabditis elegans
BAB16411 170 GPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVK 249 human
2X4D_A   171 GPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVK 250 human
3HLT_A   240 PYLTCESFPHAVDHILQH 257 human
CAB66616 240 PYLTCESFPHAVDHILQH 257 human
CAB07315 245 PDLTADCLYDAVKLIADN 262 Caenorhabditis elegans
BAB16411 250 ADGYVDNLAEAVDLLLQH 267 human
2X4D_A   251 ADGYVDNLAEAVDLLLQH 268 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap