1YDF,3PDW


Conserved Protein Domain Family
HAD-SF-IIA-hyp2

?
TIGR01457: HAD-SF-IIA-hyp2 
Click on image for an interactive view with Cn3D
HAD-superfamily subfamily IIA hydrolase, TIGR01457
This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all gram positive (low-GC) bacteria. Sequences found in this model are annotated variously as related to NagD or 4-nitrophenyl phosphatase, and this hypothetical equivalog, of all of those within the Class IIA subfamily, is most closely related to the E. coli NagD enzyme and the PGP_euk equivalog (TIGR01452). However, there is presently no evidence that this hypothetical equivalog has the same function of either those. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 130524
View PSSM: TIGR01457
Aligned: 4 rows
Threshold Bit Score: 421.956
Threshold Setting Gi: 499202026
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YDF_A         3 YKGYLIDLDGTIYKGKDRIPAGETFVHELQKRDIPYLFVTNNTTRTPESVKEMLAQnFNIDTPLSTVYTATLATIDYMND 82  Streptococcus p...
WP_003243196   4 YKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLVS-FDIPATEEQVFTTSMATAQHIAQ 82  Bacillus subtilis
WP_010899566   4 YSGFLIDLDGTMYRGSEVITEAVAFVKQLEKQSASYLFVTNNSTKSPETVATLLKS-MDVPATKEHVFTSSMAMASYLTR 82  Bacillus halodu...
3PDW_A         6 YKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLVS-FDIPATEEQVFTTSMATAQHIAQ 84  Bacillus subtilis
1YDF_A        83 LGLEKTVYVVGEAGLKEAIKAAGYVED-KEKPAYVVVGLDWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGA 161 Streptococcus p...
WP_003243196  83 QKKDASVYVIGEEGIRQAIEENGLTFG-GENADFVVVGIDRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGN 161 Bacillus subtilis
WP_010899566  83 TKEFVRAFVIGEEGLLESLKESGMMVSeDEQPDYVVMGLDRAISYEKLAKAATYVRQGAKFFITNGDAALPTEKGLMPGN 162 Bacillus halodu...
3PDW_A        85 QKKDASVYVIGEEGIRQAIEENGLTFG-GENADFVVVGIDRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGN 163 Bacillus subtilis
1YDF_A       162 GSLITLLEVATRVKPVYIGKPNAIIMDKAVEHLGLEREELIMVGDNYLTDIRAGIDNGIPTLLVTTGFTKAEEVAGLPIA 241 Streptococcus p...
WP_003243196 162 GSLTSVLTVSTGVQPVFIGKPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDMEK 241 Bacillus subtilis
WP_010899566 163 GSLAAVVATTTGVKPFVVGKPSPIIIEEALKRLGTTKEETLLIGDNYDTDILAGIHAGIDTLLVHTGVTTKEALKQKEAQ 242 Bacillus halodu...
3PDW_A       164 GSLTSVLTVSTGVQPVFIGKPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDMEK 243 Bacillus subtilis
1YDF_A       242 PTHVVSSLAEW 252 Streptococcus pneumoniae TIGR4
WP_003243196 242 PTHAIDSLTEW 252 Bacillus subtilis
WP_010899566 243 PTYTCESLADW 253 Bacillus halodurans
3PDW_A       244 PTHAIDSLTEW 254 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap