Conserved Protein Domain Family
glmM

?
TIGR01455: glmM 
phosphoglucosamine mutase
This model describes GlmM, phosphoglucosamine mutase, also designated in MrsA and YhbF E. coli, UreC in Helicobacter pylori, and femR315 or FemD in Staphlococcus aureus. It converts glucosamine-6-phosphate to glucosamine-1-phosphate as part of the pathway toward UDP-N-acetylglucosamine for peptidoglycan and lipopolysaccharides. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Central intermediary metabolism, Amino sugars]
Statistics
?
PSSM-Id: 130522
View PSSM: TIGR01455
Aligned: 8 rows
Threshold Bit Score: 633.25
Threshold Setting Gi: 489513463
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAM51442      39 FGTDGIRGKAG-ELLTAPLALSLGFWAGQVLREQTDTAGPVIIGQDSRLSSDMLANAMAAGLNSAGVEVWQLGLCPTPCV 117 Bacillus subtil...
WP_010883600   9 FGTDGVRGRANfEPMTVETTVLLGKAVARVLREGRSGKHRVVVGKDTRLSGYMFENALIAGLNSMGIETLVLGPIPTPGV 88  Chlamydia pneum...
WP_010912019   6 FGTDGIRGRANkFPMTAEIAMRVGMAAGLSF-QRGSHRHRVVLGKDTRLSGYMIENAMVAGLCAAGMDVFLLGPIPTPAV 84  Mesorhizobium loti
WP_001281065   8 FGTDGVRGKVGqYPITPDFVLKLGWAAGRVLAKQGTRK--VIIGKDTRISGYMLESALEAGLAAAGLKATFTGPMPTPAV 85  Vibrio cholerae
WP_000521411   5 FGTDGVRGEAN-LELTPELAFKLGRFGGYVLSQHETEAPKVFVGRDTRISGEMLESALVAGLLSVGIHVYKLGVLATPAV 83  Streptococcus p...
WP_010893969   7 FGTDGIRGRVGqGLISADFVLRLGNALGRVLAQGRDTRPMVLIGKDTRISGYMFESALEAGLVAAGADVQLIGPMPTPAI 86  Xylella fastidiosa
WP_010888702   7 FGTDGVRAVAGeFPLTPAWVMALGAAAGEVFKRRNPRAS-VVIGKDTRQSGDMLEAALAAGLTSRGVNVVHLGVLPTPGV 85  Deinococcus rad...
WP_003418304   5 FGTDGVRGVANrELTAELALALGAAAARRLSRSGAPGRRVAVLGRDPRASGEMLEAAVIAGLTSEGVDALRVGVLPTPAV 84  Mycobacterium t...
BAM51442     118 AYLTRKTAAIGGIMISASHNPPEDNGIKFFDHQGLKLPKSLATAIEAGLR-GQ--NQTSGLNASQWGRSYGQPHRVQYYQ 194 Bacillus subtil...
WP_010883600  89 AFITRAYRADAGIMISASHNPYRDNGIKIFSLEGFKISDVLEQRIETMVS-EA--DFGPLPEDHAVGKNKRVIDAMGRYV 165 Chlamydia pneum...
WP_010912019  85 AMLVRSLRADIGVMISASHNPYYDNGIKLFGPDGYKLSDEIEERIESMLD-KD--VELTLADSDGLGRAKRVDGVHDRYI 161 Mesorhizobium loti
WP_001281065  86 AYLTQTFRAEAGIVISASHNPYYDNGIKFFSYEGTKLPDDIELAIEAELD-KD----IECVESAELGKASRMVDAAGRYI 160 Vibrio cholerae
WP_000521411  84 AYLVETEGASAGVMISASHNPALDNGIKFFGGDGFKLDDEKEAEIEALLDaEE--DTLPRPSAEGLGILVDYPEGLRKYE 161 Streptococcus p...
WP_010893969  87 AFLTNTLRADAGVVISASHNPHDDNGIKFFSAMGEKLDDATEAA--IEAA-IE--APFLTVDSEYLGKVKRTRDAIGRYI 161 Xylella fastidiosa
WP_010888702  86 SYLTRHLGAEAGVVISASHNPYEDNGIKFFGPGGGKLSDATELEIEAAID-EA--ATLAPVTGVNLGSVTNYTEAERLYT 162 Deinococcus rad...
WP_003418304  85 AYLTGAYDADFGVMISASHNPMPDNGIKIFGPGGHKLDDDTEDQIEDLVL-GVsrGPGLRPAGAGIGRVIDAEDATERYL 163 Mycobacterium t...
BAM51442     195 DFLLGSLPQPLNFQGLKVVLDLAWGASVNLAPHIFRSLGAEVIALHDLADGSQINVDCGSTHLHRLQRAVRETGADLGFA 274 Bacillus subtil...
WP_010883600 166 EFVKATFPKGRTLKGLKIVLDCAHGASYKVAPSVFEELDAEVICYGCEPTGININEHCGALFPQVIQKAVIEHQAHLGIA 245 Chlamydia pneum...
WP_010912019 162 EFAKRTLPRSMSLSGLRIVVDCANGAAYKVAPEALWELGAEVVAINIEPNGFNINKECGSTHPAGLQKKVHEVRADIGIA 241 Mesorhizobium loti
WP_001281065 161 EFCKSTFPSKLSLSGLKLVVDCANGATYHIAPNVFRELGAEVIAMGVEPNGLNINDQVGATDVRALQKRVVEEHAHLGLA 240 Vibrio cholerae
WP_000521411 162 GYLVSTGT---PLDGMKVALDTANGAASTSARQIFADLGAQLTVIGETPDGLNINLNVGSTHPEALQEVVKESGSAIGLA 238 Streptococcus p...
WP_010893969 162 EFSKASVPRGFTLRGLKLVLDCAHGATYHIAPMLFRELGAELVAIGVDPDGLNINAGVGSTHLETLAATVRESGADLGIA 241 Xylella fastidiosa
WP_010888702 163 AFLSSHAP---DLSGMRIALDCANGAAYRVAPKVFQQAGADVFAVYTTPDGRNINRGCGSTHMDHLRLIVREGDYDLGIA 239 Deinococcus rad...
WP_003418304 164 RHVAKAATA--RLDDLAVVVDCAHGAASSAAPRAYRAAGARVIAINAEPNGRNINDGCGSTHLDPLRAAVLAHRADLGLA 241 Mycobacterium t...
BAM51442     275 FDGDADRVMAVDAQGRPVDGDYILFLWGKTLQESNHLPDNLIVGTVMANLAFERAWEKLGGKLIRTAVGDQNVQAQMWET 354 Bacillus subtil...
WP_010883600 246 LDGDGDRIIMVDEKGHIVDGDMILSICAGDLKKRSALPHNRVVATIMTNFGVLKYLEGLGLQVFTSPVGDRHVLHAMLEH 325 Chlamydia pneum...
WP_010912019 242 LDGDADRVVIVDENGAIVDGDQIMAMIAESWHQSGRLAGGGVVSTVMSNLGLERFLGDMKLQLHRTKVGDRYVVEHMRAH 321 Mesorhizobium loti
WP_001281065 241 FDGDGDRIIMVDHLGNKVDGDQIAYIIARDALRRGELKG-GVVGTLMTNLGMENGLKQLGIPFVRAAVGDRYVMEKLLEK 319 Vibrio cholerae
WP_000521411 239 FDGDSDRLIAVDENGDIVDGDKIMYIIGKYLSEKGQLAQNTIVTTVMSNLGFHKALNREGINKAVTAVGDRYVVEEMRKS 318 Streptococcus p...
WP_010893969 242 FDGDGDRVLMTDAQGRTVDGDDLLYVLARAWRASGRLKG-TVVGTLMSNYGLEQALGTLGIPFIRAKVGDRYVHQALVES 320 Xylella fastidiosa
WP_010888702 240 FDGDADRALFVDSRGNMIHGDHMLLLSARARGEK------AVVATIMTNMALEVKLQEAGLTLERTAVGDRYVHERLHAK 313 Deinococcus rad...
WP_003418304 242 HDGDADRCLAVDANGDLVDGDAIMVVLALAMKEAGELACNTLVATVMSNLGLHLAMRSAGVTVRTTAVGDRYVLEELRAG 321 Mycobacterium t...
BAM51442     355 GAMLGGEQSGHIICHHHSYSGDGLQAALHLATLVQKSGlSLSELLSESFQPYPQILRNVRVLdreRRLHWQECAPLQQAI 434 Bacillus subtil...
WP_010883600 326 EVTLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMIESE-SMLSDLTAPIVKSPQTLINVAVR---EKIPLETIPLIERTL 401 Chlamydia pneum...
WP_010912019 322 GLNVGGEQSGHIVLSDFSTTGDGLVSALQVLACIKRQG-RPVSELSKKFEPVPQLLKNVRIAg--GK-PLEEAP-VKAAI 396 Mesorhizobium loti
WP_001281065 320 GWKIGAENSGHVILLDKVTTGDAIVAGLQVLASVVGSE-MTLHELAKGMTLYPQVLENVRFAg---DNNPLEADAVKAAV 395 Vibrio cholerae
WP_000521411 319 GYNLGGEQSGHVILMDYNTTGDGQLSAVQLTKIMKETG-KSLSELAAEVTIYPQKLVNIRVEn-vMKEKAMEVPAIKAII 396 Streptococcus p...
WP_010893969 321 GGVLGGEASGHLLCLDRATTGDGIVSALQVLEVLRHEG-LTLSQALLGLHKVPQKTVNVCWSg--PARAAVEMPEVRQAL 397 Xylella fastidiosa
WP_010888702 314 GLNLGGEQSGHVLFLDVSPTGDGVLTALLTLSSMKKLG-TTLDALYDELVMFPQTLVNVRVKd--KK-AIASDPAVQHAV 389 Deinococcus rad...
WP_003418304 322 DYSLGGEQSGHIVMPALGSTGDGIVTGLRLMTRMVQTG-SSLSDLASAMRTLPQVLINVEVVd---KATAAAAPSVRTAV 397 Mycobacterium t...
BAM51442     435 ATAEKSMGTTGRILVRASGTEPLIRVMVEAACAETAAHWSDQLTSTVQC 483 Bacillus subtilis BEST7613
WP_010883600 402 RDVQDALGPSGRILLRYSGTENICRVMVEGHKKHQVDCLAKALADVIDA 450 Chlamydia pneumoniae
WP_010912019 397 EDARNRLGKAGRLVIRPSGTEPLIRVMAEGDDPQLVEAVVNDIVEVISE 445 Mesorhizobium loti
WP_001281065 396 SEVEAELGSKGRVLLRKSGTEPLIRVMVEGEDETLVKQSALKIAQAVKD 444 Vibrio cholerae
WP_000521411 397 EKMEEEMAGNGRILVRPSGTEPLLRVMAEAPTTEEVNYYVDTITDVVRA 445 Streptococcus pneumoniae
WP_010893969 398 VEAQAAVQGRGRVFLRPSGTEPVVRITVEADDVVLMQQTLDRLADVVRD 446 Xylella fastidiosa
WP_010888702 390 ADAEKQLAGKGRINLRPSGTENLIRVMVEGQDEGEIHDIAAAVAKVVEE 438 Deinococcus radiodurans
WP_003418304 398 EQAAAELGDTGRILLRPSGTEPMIRVMVEAADEGVAQRLAATVADAVST 446 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap