Conserved Protein Domain Family
AHBA_synth_RP

?
TIGR01454: AHBA_synth_RP 
3-amino-5-hydroxybenoic acid synthesis related protein
The enzymes in this equivalog are all located in the operons for the biosynthesis of 3-amino-5-hydroxybenoic acid (AHBA), which is a precursor of several antibiotics including ansatrienin, naphthomycin, rifamycin and mitomycin. The role that this enzyme plays in this biosynthesis has not been elucidated. This enzyme is a member of the Haloacid dehalogenase superfamily (pfam00702) of aspartate-nucleophile hydrolases. This enzyme is closely related to phosphoglycolate phosphatase (TIGR01449), but it is unclear what purpose a PGPase or PGPase-like activity would serve in these biosyntheses. This model is limited to the Gram positive Actinobacteria. The most closely related enzyme below the noise cutoff is IndB which is involved in the biosynthesis of Indigoidine in Pectobacterium (Erwinia) chrysanthemi, a gamma proteobacter. This enzyme is similarly related to PGP. In this case, too it is unclear what role would be be played by a PGPase activity.
Statistics
?
PSSM-Id: 130521
View PSSM: TIGR01454
Aligned: 3 rows
Threshold Bit Score: 328.375
Threshold Setting Gi: 2792325
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC01721  23 VIFDLDGVVVDSFAVMSEAFAIAYAEVVGDGPAPFEEYRRHLGRYFPDIMRIMDLPLEMEEPFVRESYRLAGEVQVFDGV 102 Amycolatopsis medit...
AAC14004   1 MLFDLDGVLVNSFAVMRQAFEIAYTEVVGDGPAPFEEYNRHLGRYFPDIMRIMGLPLEVEGPFVRESYRLAGEVEVFEGA 80  Actinosynnema preti...
AAD28462  27 VVFDLDGVLIDSFAVMREAFAVAYREVVGPGEPPFEEYRTHQGRYFPDIMRLMGLPGEMEEPFVRESHRLMDRVEVYPDV 106 Streptomyces lavend...
AAC01721 103 TELLLTLRTRGLRLAIATGKSGPRARSLLDNLGLLPFFEHVIGSDEVARPKPAPDIVRHALDLLDVPPEAAIMIGDAPTD 182 Amycolatopsis medit...
AAC14004  81 PELLADLRQHGFGTAVVTGKSGPRARSLLTTLGLAELFDHVIGSDEVVNPKPAPDMLLLATGLLGVPADRVVMVGDALTD 160 Actinosynnema preti...
AAD28462 107 PQLLAELRADGVGTAIATGKSGSRARAVLEAVGLLPLLDEVVGSDEVPRPKPHPDIVREALRRLDAAPEDAVMVGDAVID 186 Streptomyces lavend...
AAC01721 183 LASARGAGVASAAALWAPPDDIgELLAAGPDVVLRQPADLLALCPS 228 Amycolatopsis mediterranei S699
AAC14004 161 LASARAAGYPALAALWGETDEA-ELLAANPDAAVRKPSQVLDWCLA 205 Actinosynnema pretiosum subsp. auranticum
AAD28462 187 IRSGRAAGTATVGATWGEGAAG-QLRAERPDFLLDKPQSLLALVRS 231 Streptomyces lavendulae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap