Conserved Protein Domain Family
TIGR01440

?
TIGR01440: TIGR01440 
TIGR01440 family protein
Members of this family are uncharacterized proteins of about 180 amino acids from the Bacillus/Clostridium group of Gram-positive bacteria, found in no more than one copy per genome. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 130507
View PSSM: TIGR01440
Aligned: 4 rows
Threshold Bit Score: 296.715
Threshold Setting Gi: 446929105
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000654184   2 KDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKETGVTFAFQGCEHINRAITIEKS 81  Staphylococcus ...
WP_002364165  10 EQLVTITEEVITAGNLKKGDLFVLGCTTSEVVGGVIGKNSSAEVGQWIVSTLIEQLDKKGISLAVQGCEHINRALAMERR 89  Enterococcus
WP_010899891   6 QQLETVLGDLQKAKPLSSKHLLVIGVSTSEVAGKQIGTNSSKDVAAALYAALFSYQQKTGVALAFQCCEHLNRALVMERD 85  Bacillus halodu...
WP_001006361   8 RETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGHIGKESSQEIGELIVETILDILGSRGIHLAVQGCEHVNRALVVERQ 87  Streptococcus p...
WP_000654184  82 QYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHITVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATS 161 Staphylococcus ...
WP_002364165  90 VAEEKGFEIVSVVPQLHAGGSCSVAAFEKFDEPVEVEHIVAQAGIDIGDTSIGMHVKHVQVPLRLSIRTLGAAHVTALYS 169 Enterococcus
WP_010899891  86 EAEARGYEEVAVIPVRKAGGAMATYAFTQFRDPVIVEQIRADAGIDIGDTFIGMHLKRVAVPVRSSISAIGDAHVTMAYS 165 Bacillus halodu...
WP_001006361  88 VAEQFGLEIVSVHPTLHAGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVTALAS 167 Streptococcus p...
WP_000654184 162 RPKKIGGERAKY 173 Staphylococcus aureus
WP_002364165 170 RPKYIGGPRAHY 181 Enterococcus
WP_010899891 166 RPKLIGGVRANY 177 Bacillus halodurans
WP_001006361 168 RPKLIGGARAHY 179 Streptococcus pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap