2GWD


Conserved Protein Domain Family
glu_cys_lig_pln

?
TIGR01436: glu_cys_lig_pln 
Click on image for an interactive view with Cn3D
glutamate--cysteine ligase, plant type
This model represents one of two highly dissimilar forms of glutamate--cysteine ligase (gamma-glutamylcysteine synthetase), an enzyme of glutathione biosynthesis. The other type is modeled by TIGR01434. This type is found in plants (with a probable transit peptide), root nodule and other bacteria, but not E. coli and closely related species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 130503
View PSSM: TIGR01436
Aligned: 4 rows
Threshold Bit Score: 818.752
Threshold Setting Gi: 6580772
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GWD_A        15 PLT-REDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSiAERFEWEKVMEGDKIIGLKQGKQS 90  Brassica juncea
AAF18278      13 PIEsRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEkggICDLLQG-FTRFGWQPIYENDKIIGLSGDDGA 91  Zymomonas mobil...
WP_011715217   9 PVTrFDQLVTYLEAGCTPKEQWRIGTEHEKFGFRKRDLTPIPYEGeagIGRLLNSmADRYGWQRVEEDGHVIALIKDGAS 88  Magnetococcus m...
P46309        88 PLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNGiAERFEWEKVMEGDKIIGLKQGKQS 163 thale cress
2GWD_A        91 ISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLG 170 Brassica juncea
AAF18278      92 ISLEPAGQFELSGAPRSTIHESYDEICRHIQQTQEVGDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTEYMPKVGKLG 171 Zymomonas mobil...
WP_011715217  89 VTLEPGGQLELSGAPLQTIHETQDEINEHLHQLGELCQDMDMAFFGLGVQPKWRFDDIPWMPKGRYRIMRDYLPSRGHLS 168 Magnetococcus m...
P46309       164 ISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLG 243 thale cress
2GWD_A       171 LDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSF 250 Brassica juncea
AAF18278     172 LDMMLRTCTIQSNIDYGSEADMVKKFRVSLALQPLATALFANSPFLEGHPNGFSSYRSHIWTDTDPHRTGILPFVFDDDF 251 Zymomonas mobil...
WP_011715217 169 LDMMARTCTVQANFDFSSEADMVNKFRLSMALQPLTMALFANSPFLEGKPNGFLSYRGEIWRHTDPDRCGWLPFVFEEGF 248 Magnetococcus m...
P46309       244 LDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSF 323 thale cress
2GWD_A       251 GFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWR 330 Brassica juncea
AAF18278     252 GYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALPNEKPILSDWVDHLSTAFPEVRLKSYLEMRGADGASAM 331 Zymomonas mobil...
WP_011715217 249 GFARYAEYALDCPMLFLYEKGVYGSGGGVPFRAFMEGKHPAKPGVYPTLGDWQTHLSTLFPDVRLKHYLELRGADAGNSS 328 Magnetococcus m...
P46309       324 GFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR 403 thale cress
2GWD_A       331 RLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDG-LLKHVAEDVLKLAKDGLERRGYKEVG 409 Brassica juncea
AAF18278     332 MSPALSAFWISILYDSELLDTASDIIKSWSMDDYRNLRNEVPKKGLKTLIGGRqSLLDLGRQLWPLMNDALKRRAILNDK 411 Zymomonas mobil...
WP_011715217 329 SLCAMPALWKGLLHDETALLAAWDRVKRWSHEERDRIHQETPRLALQTLTPEGiSFRALGLSVLEIARASLHRQGERNAN 408 Magnetococcus m...
P46309       404 RLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDG-LLKHVAEDVLKLAKDGLERRGYKEAG 482 thale cress
2GWD_A       410 ------FLNAVTEVVRTGVTPAENLLEMYNGEWGqsVDPVFQELLY 449 Brassica juncea
AAF18278     412 gqdesrYLAPIGEILESGQSLSDRLLARYHQTGN--LDFIYQECDW 455 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
WP_011715217 409 gcdesiFLDPLFITVENNQTPAERLLEAYKGRWRgaVEPLFWEEEF 454 Magnetococcus marinus
P46309       483 ------FLNAVDEVVRTGVTPAEKLLEMYNGEWGqsVDPVFEELLY 522 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap