1ZRN,2NO4,1AQ6,3UMB


Conserved Protein Domain Family
HAD_type_II

?
TIGR01428: HAD_type_II 
2-haloalkanoic acid dehalogenase, type II
Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.
Statistics
?
PSSM-Id: 130495
View PSSM: TIGR01428
Aligned: 17 rows
Threshold Bit Score: 202.183
Threshold Setting Gi: 499337380
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZRN           4 IKGIAFDLYGTLFDVH---------------------------------S-VVGRCDEAFPGRG-----REISALWRQKQ 44  Pseudomonas sp.
CAA46976       5 LRACVFDAYGTLLDVH---------------------------------S-AVMRNADEVGASA-----EALSMLWRQRQ 45  Burkholderia ce...
CAA06738      56 PSICVFDVNETLLDIE---------------------------------Y-LGPVFQRVFGDK-------KVVREWFNQL 94  Burkholderia ce...
CAB61854       6 APLLVFDVNETLSDMS---------------------------------P-LQSRFAEIGAPP-------HLFHLWFAGV 44  Streptomyces co...
2NO4_A        14 lRACVFDAYGTLLDVH---------------------------------S-AVMRNADEVGASA-----EALSMLWRQRQ 54  Burkholderia ce...
WP_003537251   3 YAAYVFDAYGTLFDVH---------------------------------A-AVRRHAEAIGPDG-----QAFSELWRAKQ 43  Sinorhizobium m...
WP_010914527   6 PKYITFDCYGTLTHFQ-----------------------------------MAEAARDLYGSRL-----DEPRMQEFIKN 45  Mesorhizobium loti
WP_025270879   1 MRAILFDVFGTLVDWR---------------------------------SsLIEQFQALERELGgtlpcVELTDRWRQQY 47  Pseudomonas aer...
WP_009991585   5 KKILAFDLYGTILDLS------------------------------------------------------AISQEMRRKQ 30  Sulfolobus solf...
XP_961344     14 IKALTFDVFGTCVAWRekvasalasatesklssasasnstssdgmppsdQ-VLSRARSLTREDW-----ARFAQEWRRAY 87  Neurospora cras...
1ZRN          45 LEYTWLRSLMN-RYVNFQQATEDALRFTCRHLGLD--LDARTRSTLCDAYLRLAPFSEVPDSLRELKRRGLKLAILSNGS 121 Pseudomonas sp.
CAA46976      46 LEYSWTRTLMH-QYADFWQLTDEALTFALRTYHLE--DRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGN 122 Burkholderia ce...
CAA06738      95 ILYSNAVTLSG-PYTTFFTLGQGILKMLGTIHHVS--VKESDVDELRERMLTMPAHPDVPAGLKQLKEAGFRLVTLTNSP 171 Burkholderia ce...
CAB61854      45 LRDGFALTAAG-AFSDFSAVAREGVRALLSSAPEWsgDIEQAAGHVVDGLSHLEVHPDVPDGIRALRERGFRLVTMTNGS 123 Streptomyces co...
2NO4_A        55 LEYSWTRTLMH-QYADFWQLTDEALTFALRTYHLE--DRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGN 131 Burkholderia ce...
WP_003537251  44 LEYSWVRSLMG-AYVDFWELTEQSLDYAFQRFPSA--DPK-LKKPLLDAYWALDCYPEVPAVLKGLKELGARIAILSNGS 119 Sinorhizobium m...
WP_010914527  46 FAAYRLDEIMG-DWKPYADVVHNALERSCKRNGVA--FSADDARMVYERVPTWGPHADVPAGLAKVAK-EIPLVILSNAM 121 Mesorhizobium loti
WP_025270879  48 KPAMDRVRNGQaPWQHLDQLHRQSLEALAGEFGLA--LDEALLQRITGFWHRLRPWPDTLAGMHALKAD-YWLAALSNGN 124 Pseudomonas aer...
WP_009991585  31 LEYTWLLTIMG-RYVDFDEITKIAISYTLGEDKIE--EE-------LNKWRSLRTHQDAIY-LKDIST-IADIYILSNGT 98  Sulfolobus solf...
XP_961344     88 GDWTRSFVPDDtPWMDTDTFHLDSLVDLLANWQLDglFTMPEIEKLSLTWHDLPPWPDTIQGLNLLGSR-YHTVALTNAN 166 Neurospora cras...
1ZRN         122 PQSIDAVVSHAG----LRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNA-WDATGARYFGFP-TCWIN 195 Pseudomonas sp.
CAA46976     123 DEMLQAALKASK----LDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNA-WDLGGAGKFGFN-TVRIN 196 Burkholderia ce...
CAA06738     172 PDPNVSPLKHAG----IDGFFEKSLSIDRVRRFKPAPQVYHMAAEELNVTPSAICMVAAHV-WDTIGAQSVGCA-GALVA 245 Burkholderia ce...
CAB61854     124 SDLSKRLLGRAG----LADCFESHLDASGPQRWKPAQAAYQYVVEQVGVRLDEAVLVAVHP-WDVDGAQRAGLG-GAWLR 197 Streptomyces co...
2NO4_A       132 DEMLQAALKASK----LDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNA-WDLGGAGKFGFN-TVRIN 205 Burkholderia ce...
WP_003537251 120 PAMLASAVKNAA----LDIIIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNR-WDIAGATKFGFR-TVWIN 193 Sinorhizobium m...
WP_010914527 122 NAQIMSNVEKLG------APFHAVYTAEQAQAYKPRFQAFEYMFDRLGCGPEDILHCSSSFrYDLMSAHDLGIKnKVWVN 195 Mesorhizobium loti
WP_025270879 125 TALMLDVARHAG----L--PWDMLLCADLFGHYKPDPQVYLGACRLLDLPPQEVMLCAAHN-YDLKAARALGLK-TAFIA 196 Pseudomonas aer...
WP_009991585  99 TKTIEELLKLNG----LSSYFKGIFSAERVKEYKPSPKVYRYFLEAV---KGEAYLVSSNP-FDVIGAKNSGMK-GIYVN 169 Sulfolobus solf...
XP_961344    167 QATLKDLNSQKGvddsLPLGFQRLLSCDMYRAYKPNPKVYQGGLRDLDLQPGEVAMVAAHL-GDLGAAKKEGMR-AIYVA 244 Neurospora cras...
1ZRN         196 RTGNVF 201 Pseudomonas sp.
CAA46976     197 RQGNPP 202 Burkholderia cepacia
CAA06738     246 RPGNAP 251 Burkholderia cepacia
CAB61854     198 RDAADY 203 Streptomyces coelicolor A3(2)
2NO4_A       206 RQGNPP 211 Burkholderia cepacia
WP_003537251 194 RADGPD 199 Sinorhizobium meliloti
WP_010914527 196 RGHEPA 201 Mesorhizobium loti
WP_025270879 197 RPLEYg 202 Pseudomonas aeruginosa
WP_009991585 170 RRNMPV 175 Sulfolobus solfataricus
XP_961344    245 RPGELD 250 Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap