Conserved Protein Domain Family
dnaQ_proteo

?
TIGR01406: dnaQ_proteo 
DNA polymerase III, epsilon subunit, Proteobacterial
This model represents DnaQ, the DNA polymerase III epsilon subunit, as found in most Proteobacteria. It consists largely of an exonuclease domain as described in pfam00929. In Gram-positive bacteria, closely related regions are found both in the Gram-positive type DNA polymerase III alpha subunit and as an additional N-terminal domain of a DinG-family helicase. Both are excluded from this model, as are smaller proteins, also outside the Proteobacteria, that are similar in size to the epsilon subunit but as different in sequence as are the epsilon-like regions found in Gram-positive bacteria. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130473
View PSSM: TIGR01406
Aligned: 7 rows
Threshold Bit Score: 338.6
Threshold Setting Gi: 488147182
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZCJ9         5 REIILDTETTGLDPQQ----G-----HRIVEIGAIEMVNKVLTGKHFHFYINPERDMPFEAYKIHGISGEFLKDK--PLF 73  Rickettsia prow...
WP_001098051  11 RIVVLDTETTGMNREG----GphyegHRIIEIGAVEIINRKLTGRHFHVYLKPDRDIQLEAIEVHGITDEFLKDK--PEY 84  Vibrio cholerae
WP_010894606   6 RQIVLDTETTGLEWSK----G-----NRIVEIGAVELLDRRLSGDKFHRYLKPDVSFESGAQEVTGLTMEFLADK--PEF 74  Xylella fastidiosa
WP_010896025   5 RTIILDTETTGINQTSlphiN-----HRIIEIGAVEIIDRCFTGNNFHVYIQPGRSIESGALKVHGITNKFLLDK--PIF 77  Buchnera aphidi...
WP_011711731   3 RLIVLDTETTGFDPKE----G-----HRIIEIGCVELVN-MRKGDERQWYVNPEREIPADATKVHGITDADVANS--PKF 70  Magnetococcus m...
WP_010917896   3 REIILDTETTGFDPKT----G-----DRLVEIGCIEVVDFMPTGRSFHEYCDPLRDMPAEAEKVHGLSSAFLTGK--PKF 71  Caulobacter vib...
WP_002218390   4 RQIILDTETTGLYADG----G-----DRLVEFAGLEMVNRQMTDKNLHLYVHPERDMPEEAARVHGLTIEVLEGKnaPPF 74  Neisseria menin...
Q9ZCJ9        74 KTIANDFLKFIADSTLIIHNAPFDIKFLNHELSLLK-RtEIK-FLELTNTIDTLVMARNMFPGARYSLDALCKRFKVDNS 151 Rickettsia prow...
WP_001098051  85 KDVHEEFVDFIKGAELVAHNAPFDVGFMDYEFAKLG-G-AIGkTSDFCKVTDTLAMAKRIFPGKRNNLDILCERYGIDNS 162 Vibrio cholerae
WP_010894606  75 SMIADEFLAYINGAELIIHNAAFDLGFLDYELSRLG-S-QYGkITDRASVLDTLVMARERYPGQRNSLDALCKRLGVDNA 152 Xylella fastidiosa
WP_010896025  78 KDIADSFLNYIKNSILVIHNASFDVGFINQELEILN-K-KIK-INTFCSIIDTLKIARELFPGKKNTLDALCTRYKINKS 154 Buchnera aphidi...
WP_011711731  71 KEIYHEFLAFIGEDSLVIHNAEFDMRFLNAELTRLN----KRlVMPMERAIDTIPLARRKFPGSTVNLDALCKRLGVDNS 146 Magnetococcus m...
WP_010917896  72 HEIADRFLDFVGDSVVVAHNAAFDRQFVNFELEKCG----KApIHE-ERWVDTLAMAKKRFPGMYNSLDALCKRFKISLE 146 Caulobacter vib...
WP_002218390  75 AEVGRQIADFLRGAELIIHNAKFDVGFLNMEFRRMGlP-TVEeLG--CTVTDTLAMAREMFPGQKASLDALCNRFSVDRS 151 Neisseria menin...
Q9ZCJ9       152 GRQLHGALKDAALLAEVYVALTGGRQSTFK-MINKPDEINNLAVKCVDVQQIKRGIVVKPT-----KEELQKHKEFIDKI 225 Rickettsia prow...
WP_001098051 163 HRTLHGALLDAEILADVYLLMTGGQTSLQFsSVTQNSGELSAESLKRARSERKALKVLAAS-----ADELQAHQDRLDIV 237 Vibrio cholerae
WP_010894606 153 HRQLHGALLDAQILADVYIALTSGQEEIGFaLPESSRGGVDAASVAFMPDVLLTRPCVVVS-----QSELEAHEARLAKL 227 Xylella fastidiosa
WP_010896025 155 HRNLHSAIVDSYLLGKLYLLMTGGQDSLFS-DNTINYKENFKKLKKNIQLKNNTLRILHPT-----LKENDLHEKYLQYM 228 Buchnera aphidi...
WP_011711731 147 GRTFHGALLDAHLLAEVYVELMGGNQFSLE-MAADESGRIAQPSDSPKDGAPGPGLMMAPRdwqvsEESTQAHEAFLQLL 225 Magnetococcus m...
WP_010917896 147 SRDKHGALIDAHLLAEVYLELQGGKERALE-LTHSTGAMAVSTAIQG--VYAARSRPLAPRs---tDAEREIHAAWVRKN 220 Caulobacter vib...
WP_002218390 152 KRVLHGALIDCELLGEVYLAMTRRQFDLMG-EAEE-EEPAAKPVASAEMKLGAKLKVIKAD-----EAELAAHGQYLDGL 224 Neisseria menin...
Q9ZCJ9       226 LIQA 229 Rickettsia prowazekii str. Madrid E
WP_001098051 238 AKSG 241 Vibrio cholerae
WP_010894606 228 RKIA 231 Xylella fastidiosa
WP_010896025 229 KDKS 232 Buchnera aphidicola
WP_011711731 226 DRES 229 Magnetococcus marinus
WP_010917896 221 LKDK 224 Caulobacter vibrioides
WP_002218390 225 Geac 228 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap