Conserved Protein Domain Family
FlhB_rel_III

?
TIGR01404: FlhB_rel_III 
type III secretion protein, YscU/HrpY family
This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FlhB (TIGRFAMs model TIGR00328). This model may not identify all type III secretion system FlhB homologs. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130471
View PSSM: TIGR01404
Aligned: 14 rows
Threshold Bit Score: 408.203
Threshold Setting Gi: 547676
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB06008       2 AEKTEKPTAKKLQDARRKGQVPQSQDVPKLLICAGVVETVLALDDVGMQKLQALMMLPLARI-GQPFELALSEVVSSA-I 79  Erwinia amylovora
P96069         2 SEKTEQPTEKKLRDGRKEGQVVKSIEITSLFQLIALYLYFHFFTEKMILILIESITFTLQLV-NKPFSYALTQLSHAL-I 79  Salmonella ente...
AAD16831       3 GEKTEQPTPKKIRDARKKGQVAKSKEVVSTTLIVALSAMLMGLSDYYFEHLSRLMLIPAEQS-YLPFSQALSYVVDNv-L 80  Yersinia entero...
CAC09184       3 GEKTERPTPKRLRDSREKGEVAHSRDFTQTALICALFGHFLINAPSILASLRALILAPAAFA-DQGFAVALGPVLTEi-L 80  Bordetella pert...
AAB05078       2 SEKTEKATPKQLRDAREKGQVGQSQDLGKLLVLMAVSEITLALADESVNRLEALLSLSFQGI-DRSFAASVELIASEG-F 79  Pseudomonas syr...
P35652         3 DEKTEQPTDKKLEDAHRDGETAKSADLTAAAVLLSGCLLLALTASVFGERWRALLDLALDVDsSRHPLMTLKQTISHFaL 82  Ralstonia solan...
P40707         2 ANKTEKPTPKKLKDAAKKGQSFKFKDLTTVVIILVGTFTIISFFSLSDVMLLYRYVIINDFE-INEGKY-FFAVVIVF-F 78  Shigella flexneri
AAF82331       2 AEKTEKPTDKKIRDSAKKGQSFKSKDMVAAVVLVAGAFAISGFSSLYGLGSLLQRILLSPSD-IGVEAL-LDKLYSLF-L 78  Yersinia entero...
WP_001291694   2 SEKTEKPTPKKLRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYGMSFFVDIVGLVNTTIDSL-NRPFLYAIREILGAV-L 79  Escherichia coli
WP_010230256   2 GEKTEKATPKRLRDARKKGQVAKSQDFPSAITFIVSMFMTFSLSSFFAEHLGGFLVSIFRTA-PQQHDPRLAVYYLKNcL 80  Chlamydia murid...
AAB06008      80 ILVATFCGLTVAIAALLRIIGGWIQYGPLFAPEALQPDFNRLNPINQFKQMFSVKKLSEMLNSIVKAVAICTIFYLVLTP 159 Erwinia amylovora
P96069        80 ESLTSALLFLGAGVIVATVGSVFLQVGVVIASKAIGFKSEHINPVSNFKQIFSLHSVVELCKSSLKVIMLSLIFAFFFYY 159 Salmonella ente...
AAD16831      81 LEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKG 160 Yersinia entero...
CAC09184      81 DQAVRVLAPLILIVLGVGMFAEFLQVGVVLAFRKLKPSAEKLNPAGNLKNIFSARNLMEFIKSVCKILFLAVLVTLVIRD 160 Bordetella pert...
AAB05078      80 SVLLSFTLCSVGIAMLMRLISSWMQIGFLFAPKALKIDPNKINPFSHAKQMFSGQNLLNLLLSVLKAIAIGATLYVQVKP 159 Pseudomonas syr...
P35652        83 QLVLMTLPVGFVFALVAWIATWA-QTGVVLSFKPVELKMSAINPASGLKRIFSVRSMIDLVKMIIKGVAVAAAVWKLILI 161 Ralstonia solan...
P40707        79 KIIGFPLFFC----VLSAVLPTLVQTKFVLATKAIKIDFSVLNPVKGLKKIFSIKTIKEFFKSILLLIILALTTYFFWIN 154 Shigella flexneri
AAF82331      79 QAVVPVLLAC----FLPGAIISLLQSRFRLATEAVKIDFSHLNPISGFKKIFALRSLKELVKAFLYLLVFATSAAVFFIF 154 Yersinia entero...
WP_001291694  80 NIFLLYILPISLIVFVGTVTTGVSQIGFIFAVEKIKPSAQKISVKNNLKNIFSVKSIFELLKSVFKLVIIVLIFYFMGHS 159 Escherichia coli
WP_010230256  81 MLILTVSLPLLGAVGFVGLLIGFLVVGPTFSTEVFKPDLKKFNPIENLKQKFKLKTFIELLKSIFKISGAALILYIVLKN 160 Chlamydia murid...
AAB06008     160 DLESLSRLAYGDLDSFWPAVETLLIHVSRQTLLTLLVLTLLDFGLQKYFFIKQQRMSHQDIRDEHKQSEGDPHMKGHRHA 239 Erwinia amylovora
P96069       160 YASTFRALPYCGLACGVLVVSSLIKWLWVGVMVFYIVVGILDYSFQYYKIRKDLKMSKDDVKQEHKDLEGDPQMKTRRRE 239 Salmonella ente...
AAD16831     161 NLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ 240 Yersinia entero...
CAC09184     161 SLQPLMAVPHSGLDGLRTGVGRILQVMVWNIGLAYGAISLADLAWQRYQYRKGLRMSKDEVKQEYKEMEGDPHIKQQRKH 240 Bordetella pert...
AAB05078     160 VLGTLAVLANSDLTTYWHALVELFRHILRVILGLLLAIAMIDFAMQKYFHAKKLRMSHEDIKKEYKQSEGDPHVKGHRRQ 239 Pseudomonas syr...
P35652       162 LMPSIVGAAYQSVMDIAEIGMTLLVRLLAAGGGLFLILGAADFGIQRWLFIRDHRMSKDEVKREHKNSEGDPHIKGERKK 241 Ralstonia solan...
P40707       155 DRKIIFSQVFSSVDGLYLIWGRLFKDIILFFLAFSILVIILDFVIEFILYMKDMMMDKQEIKREYIEQEGHFETKSRRRE 234 Shigella flexneri
AAF82331     155 WRQEIFMLYRTTINGMISQWAHLCITFIMVFLAVALLILLIDTLTEFFLFMKDLKMEKQEVKKEYKDNDGDPHIKSARRG 234 Yersinia entero...
WP_001291694 160 YANEFANFTGLNAYQALVVVAFFVFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKREAKDTDGNPEIKGERRR 239 Escherichia coli
WP_010230256 161 RVELVIETAGVPPLVTAQIFKEILYKAVTSIGMFFLVVAVIDLVYQRHSFAKELKMEKFEVKQEFKDTEGNPEIKGRRRQ 240 Chlamydia murid...
AAB06008     240 LAHELLNQPATAVkskpVEEADLLLVNPTHYAVALYYRPELTPLPRIICKGEDQQAKELIARAQQANIPVIRFIWLARTL 319 Erwinia amylovora
P96069       240 MQSEIQSGSLAQS----VKQSVAVVRNPTHIAVCLGYHPTDMPIPRVLEKGSDAQANYIVNIAERNCIPVVENVELARSL 315 Salmonella ente...
AAD16831     241 FHQEIQSGNMREN----VKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARAL 316 Yersinia entero...
CAC09184     241 LHQELIMHGAAAQ----VRRATVLVTNPTHLAVALYYAAGETPLPRVLAMGQGAVAALMVEAARDAGVPVMQNVALARAL 316 Bordetella pert...
AAB05078     240 LAQEILNQEPSAApk-pLEDADMLLVNPTHYAVALYYRPGETPLPLIHCKGEDEEALALIARAKKAGIPVVQSIWLTRTL 318 Pseudomonas syr...
P35652       242 LARELADEAKPKQs---VAGAQAVVVNPTHYAVAIRYAPEEYGLPRIIAKGVDDEALALREEAAALGIPIVGNPPLARSL 318 Ralstonia solan...
P40707       235 LHIEILSEQTKSD----IRNSKLVVMNPTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKL 310 Shigella flexneri
AAF82331     235 LHQEILSEEVKSN----VRGSTFVMANPTHIAMVIYYNDDIAPLPYLMMKTRGLQAKAVIAYAESQGVPVVRDIPVARQL 310 Yersinia entero...
WP_001291694 240 LHSEIQSGSLANN----IKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARTL 315 Escherichia coli
WP_010230256 241 IAQEIAYEDTSSQ----IKHASAVVSNPKDIAVAIGYMPEKYKAPWIIAMGVNLRARRIIAEAEKYGVPIMRNVPLAHQL 316 Chlamydia murid...
AAB06008     320 YRS-QEGQLIPRHTLQAVAQVYRVLRQL 346 Erwinia amylovora
P96069       316 FFEvERGDKIPETLFEPVAALLRMVMKI 343 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAD16831     317 YWDaLVDHYIPAEQIEATAEVLRWLERQ 344 Yersinia enterocolitica W22703
CAC09184     317 HDQaEVDQYIPGELVEPVAAVLRAVRQA 344 Bordetella pertussis
AAB05078     319 YRS-KVGKYIPRPTLQAVGHIYKVVRQL 345 Pseudomonas syringae pv. syringae
P35652       319 Y-RvDLYGPVPEPLFETVAEVLAWVGEM 345 Ralstonia solanacearum GMI1000
P40707       311 YKThTKYSFVDFEHLDEVLRLIVWLEQV 338 Shigella flexneri
AAF82331     311 WRNyRKDSFINDQGLDDVMHIINWLVRV 338 Yersinia enterocolitica
WP_001291694 316 YKNiHKGQYITEDFFEPVAQLIRIAIDL 343 Escherichia coli
WP_010230256 317 LDEgKELKFIPETTYEAVGEILLYITSL 344 Chlamydia muridarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap