Conserved Protein Domain Family
fliQ_rel_III

?
TIGR01403: fliQ_rel_III 
type III secretion protein, HrpO family
This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FliQ. This model may not identify all type III secretion system FliQ homologs. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130470
View PSSM: TIGR01403
Aligned: 8 rows
Threshold Bit Score: 74.2839
Threshold Setting Gi: 489356744
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P74891        5 ELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAITLMVSYPWLSGILLNYTRQIMLRI 84  Salmonella enter...
AAB06006      2 DILNLFKQAMLLVVLLSAPPLLVAVIVGVLVSLLQAVMQLQDQTLPFAIKLVAVGIALALSGRWIGVELLELAQQAFTMI 81  Erwinia amylovora
CAC09182      5 DLVSFMTQALYLVLWLSLPPIAVVAIVGTLFSLLQALTQVQEQTLSFAVKLIAVFATLMLAARWISAEIYNFTIAVFDAF 84  Bordetella pertu...
WP_001280545  3 DIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLQTVTQLQEQTLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLI 82  Shigella
WP_000379425  5 YFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQDQTLPFLLKIIAVFATLALTYHWMGTTIINFSSIIFEMI 84  Escherichia coli
WP_010231754 11 MLFEYSYEALLLILIISAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTLMITGGWLCSMILRFAAQIFTNF 90  Chlamydia muridarum
WP_021264587  5 DILHFTNQTLWLVLVLSLPPVLVAALIGTLVSLVQALTQIQEQTLGFVAKLVAVVVVLFATSGWLGGELYRFAEMTLLKV 84  Pseudomonas aeru...
WP_003263753  5 NITRLTSTALLLCLLVSLPAVGVAAIAGLLISFLQAITSLQDSSISHGLKLIIVSLVIVVAAPWGAAAILQFANSIMQTL 84  Ralstonia solana...
P74891       85 G 85  Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAB06006     82 P 82  Erwinia amylovora
CAC09182     85 H 85  Bordetella pertussis
WP_001280545 83 K 83  Shigella
WP_000379425 85 P 85  Escherichia coli
WP_010231754 91 Y 91  Chlamydia muridarum
WP_021264587 85 P 85  Pseudomonas aeruginosa
WP_003263753 85 F 85  Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap