Conserved Protein Domain Family
fliQ

?
TIGR01402: fliQ 
flagellar biosynthetic protein FliQ
This model describes FliQ, a protein involved in biosynthesis of bacterial flagella. A related family of proteins, excluded from this model, participates in bacterial type III protein secretion systems. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 130469
View PSSM: TIGR01402
Aligned: 12 rows
Threshold Bit Score: 73.0674
Threshold Setting Gi: 416998
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33134        1 MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYVRTL 80  Escherichia coli
P35535        1 MSSEFVISMAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLLALIFFGPWMLSTILSFTTEL 80  Bacillus subtili...
P74931        2 MTQGAVLGLIREGVFQVVLLVAPVLCTALVVGLIVAIFQAVTSIQEQTLTFVPKMLTILGMIALLGGWMLTMLQNYTVRL 81  Treponema pallid...
Q44906        1 MTAGHILYLIRISIENIIILSAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLVIVIFGPWILNKLMQFTYMI 80  Borrelia burgdor...
AAC32323      1 MDFDGSIEHLRLAYWNILLTAGPVLGVALAVGLVIGILQAATSINESTLSFVPKLAIVLLTMALASSFMLTRMTDYFAFV 80  Rhodobacter spha...
O67774        1 MEQDLIVSLGQRALEMTLLLALPVLLSTFVVGLVVSIFQAATQIQEMTLSYIPKVITAFLVIFLLGGWMMRKLVDFAVEI 80  Aquifex aeolicus...
Q45974        1 MTGAEVLDVGRDAIWLTLQLCAPVLIVGLVVGVIIGLFQALTQIQEATLVYAPKIVAIFISLLIFLPLMGSLMSGFMRQI 80  Caulobacter cres...
WP_011711712  1 MTADTVQNLVVEALRLALLISAPMLLTALVVGITISLLQAVTQIQEMTLTFIPKILATFLALMLTLPWMIQKLTDYFRHL 80  Magnetococcus ma...
WP_000187051  1 MTPEIFVELFKESLWLVLIMVCAIIIPSLLVGLVVAIFQAATSINEQTLSFLPRLIITLLALMFFGHWMTQILMDFFYSM 80  Vibrio cholerae
WP_010911298  1 MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQIQEITLTFVPKIVAIMLVVALTGPFIGGQISAFTNVI 80  Mesorhizobium loti
WP_004081052  1 MTIEVFLDIMKSGISLLLEIIVPPLVVSLIVGLVISIFQAVTQIHEQTLMFAPRIIVLFLTILFLSGWMAQKILDFFSEM 80  Thermotoga
WP_002851290  1 MDESTLVALGVQTFKITLLLSLPMLLAGLIAGLVISIFQATTQINEMTLSFVPKIILVVVILIFLMPWMTTTMIDFTENI 80  Campylobacter je...
P33134       81 FTNLPYII 88  Escherichia coli
P35535       81 FSNLNRFA 88  Bacillus subtilis subsp. subtilis str. 168
P74931       82 FDIIPQLV 89  Treponema pallidum subsp. pallidum str. Nichols
Q44906       81 FSQLQNV- 87  Borrelia burgdorferi B31
AAC32323     81 FETIATIR 88  Rhodobacter sphaeroides
O67774       81 FANIPVWI 88  Aquifex aeolicus VF5
Q45974       81 AARIA-GM 87  Caulobacter crescentus CB15
WP_011711712 81 FDTIPTLI 88  Magnetococcus marinus
WP_000187051 81 IERMPQVL 88  Vibrio cholerae
WP_010911298 81 FQRIQNGF 88  Mesorhizobium loti
WP_004081052 81 LQKYFQMI 88  Thermotoga
WP_002851290 81 LNQIPTFI 88  Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap