Conserved Protein Domain Family
fliR_like_III

?
TIGR01401: fliR_like_III 
type III secretion protein SpaR/YscT/HrcT
This model represents members of bacterial type III secretion systems homologous to the flagellar biosynthetic protein FliR (TIGRFAMs:TIGR01400). [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130468
View PSSM: TIGR01401
Aligned: 11 rows
Threshold Bit Score: 212.906
Threshold Setting Gi: 49082920
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB05077       5 AHSAFQFMLGMGLAMARLMP------CMLLVPAFCFKYLKG-PLRYAVVAVMAMIPAPAITRALESLDDNw--FAIGGLL 75  Pseudomonas syr...
CAC09183       7 FVEAKVFLGTLAMTQPRILT------AMLFLPMFNRQFLPG-PLRYAVGACLGLIVVPQLAPQYAALDIDw--PRLLALL 77  Bordetella pert...
BAB60840       6 LYQLHSLLAATALGFCRLAPtfyllpFFYLLPFFASGNIPT-VVRHPIIIVVSCALVQHYHYELLNLNEI----DIALFA 80  Escherichia coli
AAG48606       6 WSSLFEWLITLAVVSARITP------AFFLLPFLAPAWLSL-TVRTPVIFFIGAALWPYSFGAMASLDGA----RIADIL 74  Sodalis glossin...
BAA02831       7 FESIHVFLILLNGVFFRLAP------LFFFLPFLNNGIISP-SIRIPVIFLVASGLITSGKVDIGSSVFE----HVYFLM 75  Shigella flexneri
AAF82330      13 YSTFQTGLMTLALAWARIAP------VFFFLPFLSSKLLNSgMIKNCVAVFLALGMWPFFSTYELNWEET----SLGEMI 82  Yersinia entero...
P96068         2 AQQVNEWLIALAVAFIRPLS------LSLLLPLLKSGSLGAaLLRNGVLMSLTFPILPIIYQQKIMMHIGk-dYSWLGLV 74  Salmonella ente...
AAB08463      12 SSQGVSLLTLLALCGVRVFV------MFIVLPATAQDSLPG-IARNGVIYVLSSFIAYGQPADALAKIQT---AGLVGVV 81  Xanthomonas euv...
WP_010913976  12 MHTAIELVVAAGLGAARAIG------IMMILPVFTRSQTDG-LIRGCLAVGFGLPCLAHVSDALQALDPEtrlIEVALLG 84  Mesorhizobium loti
WP_001002833   1 MNEIMTVIVSSFYCILRPLG------MFIILPIFSTGVLLSnFIRNSIMIAFTLPIIVENYTFSEKLPSGi--FQLTGIA 72  Escherichia coli
AAT50860       3 vqdlqqllltyslllPRIIS------CFVVLPVLAKQTLGGgLVRNGVACSLALFAYPIVAGSLPPALGA---LDIALLI 73  synthetic const...
AAB05077      76 IKEAVLGTLLGLLLYAPFWMFASVGALLDSQRGALS-GGQLNPALGPDATPLGELFQETLIMLVILTGGLSLMTQIIWDS 154 Pseudomonas syr...
CAC09183      78 AKEAMVGMFLGWLAALPFWIFEAIGFVIDNQRGASL-GAILNPATGNDSSPMGILFNLGFMVFFLTAGGFGLFATMLYDS 156 Bordetella pert...
BAB60840      81 AREIIIGLFIACLLASPFWMFLAIGSFIDNQRGATL-SSTLDPATGVDTSELARLFNLFSAAVYLTKGGMNFILETLWQS 159 Escherichia coli
AAG48606      75 LREVAIGLLLAILLALPFWVMHGLGALIDYQRGALL-SSAYDPISGVDTSELAKFFNLFFAAVFLQGGGLTLLLEVFLGS 153 Sodalis glossin...
BAA02831      76 FKEIIVGLLLSFCLSLPFWIFHAVGSIIDNQRGATL-SSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLS 154 Shigella flexneri
AAF82330      83 LYELAIGLVLAFILSLPFLIANIIGELIDNQRGATI-SDTIDPANGVESSEMSVLVSHIVVMIFLTQGGMYQLAQTFAES 161 Yersinia entero...
P96068        75 TGEVIIGFSIGFCAAVPFWAVDMAGFLLDTLRGATM-GTIFNSTIEAETSLFGLLFSQFLCVIFFISGGMEFILNILYES 153 Salmonella ente...
AAB08463      82 FKEAFVGLLIGFAASTVFWIAESVGLLIDDLAGYNN-VQMTNPLSGQQSTPVSTVLLQLAIVSFYALGGMLMLLGALFES 160 Xanthomonas euv...
WP_010913976  85 LKEVLVGALLGTFLGIPLWGLQAAGEFIDNQRGVTNpSAPTDPATNSQASAMGVFLGITAIAIFVASGGLETLIGALYGS 164 Mesorhizobium loti
WP_001002833  73 LKEISIGFFIGLSFTILFWAIDAAGQIIDTLRGSTI-SSIFNPSISDSSSITGVILYQFISVIFVIHGGIQSILDKLYLS 151 Escherichia coli
AAT50860      74 GKEVLLGLLIGFVATIPFWAMEATGFIIDNQRGAAL-ASTFNPSLGSQTSPTGLLLTQTLITLFFSGGAFLALVGSLFRS 152 synthetic const...
AAB05077     155 YSVWPPTAWLpGMNAGGLDVFLEQLNQTMQHMLLYAAPFIALLLLIEAAFAIIGLYAQQLNVSILAMPAKSMAGLAFLLI 234 Pseudomonas syr...
CAC09183     157 FGLWNIWAWWpSMPAQGAVRMLDQFSGFAARVLLLASPAIVAMFLAELGLALISRFAPQLQVFFLALPVKSALVLFVLVL 236 Bordetella pert...
BAB60840     160 YNLWLSGN----FNFPKLEPLFSYINNIMTHTIVYASPVIAVMLGGEAVLGLLACYASQLNAFAISLTVKSALAFLILII 235 Escherichia coli
AAG48606     154 YQLCDPLE----PSLPSLAKVTTLLQTMATRILILSSPVLVVLLLIEISLGLLSRFAPQMNAFAIALTLKSGVTFFIILI 229 Sodalis glossin...
BAA02831     155 YNICPLFS----QCSFRVSNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSLLAIFIIFI 230 Shigella flexneri
AAF82330     162 YRLLPFAAG---FSHFDSLPLGRWLNQLVVQAIVLAAPILVTLFITEVALGLYSRFCPQLNAFSLSLTIKSAIAFMVFLL 238 Yersinia entero...
P96068       154 YQYLPPGRTL-LFDQQFLKYIQAEWRTLYQLCISFSLPAIICMVLADLALGLLNRSAQQLNVFFFSMPLKSILVLLTLLI 232 Salmonella ente...
AAB08463     161 FRWWPLTQLGpNMGAVAESFVIQQSDSMMAAVVKLSAPVMLVLVLVDLAIGLVARAADKLEPSNLSQPIRGVLALLLLAL 240 Xanthomonas euv...
WP_010913976 165 YLIWPVYKFYpTLSTQGAMEVLGLLDQIMRTALLVSGPVVFFMTLIDVSFMLLRRFAPQFKLTQLSPAIKNLVFPILMVT 244 Mesorhizobium loti
WP_001002833 152 YEILPLQADI-AFNRALIDFLFSLWDSFIKLMLSFSVPMIIGIFLCDMGFGFLNKTAPQLNVFTLSLPVKSLIAIFILLL 230 Escherichia coli
AAT50860     153 YASWPVSSFFpQLGSQWVAFFYAQFSQMLMLCALFAAPLLIAMFLAEFGLALVSRFAPSLNVFILAMPIKSLVASLLLVL 232 synthetic const...
AAB05077     235 YLPTLLELGTGQLLKLVDLKSLLTL 259 Pseudomonas syringae pv. syringae
CAC09183     237 YMATLFQYAGEILGSVGRIVPFLHS 261 Bordetella pertussis
BAB60840     236 YFAPILAERVMPLSFFPEQLQLYIE 260 Escherichia coli
AAG48606     230 YFAPLLPEIFRQYWLLPSQLEIWLS 254 Sodalis glossinidius
BAA02831     231 CSSTIYFSKVQFFLGEHKFFTNLFV 255 Shigella flexneri
AAF82330     239 YFQNEVPTILINMISLSPLHDIFGV 263 Yersinia enterocolitica
P96068       233 SFPYALHHYLVESDKFYIYLKDWFP 257 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAB08463     241 LTSVFIAQFGEALGFLHFQQQLHDA 265 Xanthomonas euvesicatoria
WP_010913976 245 YAGYLVEGMKLEITQANGALEWFDR 269 Mesorhizobium loti
WP_001002833 231 VIH--VFPDFITANIHSDIIDRSLP 253 Escherichia coli
AAT50860     233 YLGILMEHAYDALLLAVDPLRLLRP 257 synthetic construct
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap