Conserved Protein Domain Family
fliR

?
TIGR01400: fliR 
flagellar biosynthetic protein FliR
This model recognizes the FliR protein of bacterial flagellar biosynthesis. It distinguishes FliR from the homologous proteins bacterial type III protein secretion systems, known by names such as YopT, EscT, and HrcT. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 130467
View PSSM: TIGR01400
Aligned: 15 rows
Threshold Bit Score: 127.727
Threshold Setting Gi: 3913681
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P74932        12 ASLFFLAAVRVFALMFTVPLLSVRSVSRVVRVALAGLIAFLVLPLAYPAPm-QVREFSAYYVLLLLGEGLLGILTGFFIS 90  Treponema palli...
AAC32324      19 LTGAFVASLRIGAFLIASPAFGGRFVPLPVRIVATVILTLPVLGRVELPP--PEELASLAAIPLMMQEIAVGLSAGLVLT 96  Rhodobacter sph...
O67773        10 LITLLLSYFRIVSFLFTFPFYGSFLIPNTIRLYLAFALSFAVLSFINITP--VKVNTFVEFLVYALNELLFGFSAGLILR 87  Aquifex aeolicu...
Q44907        17 SFTILPVLVRIFMFLKFSPFFSTIKIG-YFNFFFSLILSVIVVEKIKIIYp---LDNMLSFALILLGEAILGLIQAFFVN 92  Borrelia burgdo...
WP_000883720  13 VRDFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSN---AAYTPEGFIIACLCELFLGVCASVFLQ 89  Helicobacter py...
WP_010898593   8 LPMFLLVFVRMLAFLMTMPLFSYRNIPAMFKVGIALFLAWILTFSLEPEIi----LFDGTYVILIMKEVLVGLMVGLIAM 83  Bacillus halodu...
WP_004080654  12 FLAWMCIFTRFTGFFLIAPFFSERAFPVVVRVLLGLFTSWLMLFTVDVSIp--LNTPVLSFTLNLFFNFLVGFGIGFIVY 89  Thermotoga
WP_002878542  12 VVTFMLLLARMGGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLARL----ESLHLDSFFVLQLISEVIFGMIAGLMLQ 87  Campylobacter j...
WP_010895936  13 ISNFFWPMIRVLSFFSVAPIFKEKLINRKSKILLSGMISWLVWPFLPEVH---TVLFSYFGFLLILQQILIGIVLGFTAQ 89  Buchnera aphidi...
WP_010911311   9 VIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDRIipFVDPRPQILVPMIISELLIGGLIGAMTR 88  Mesorhizobium loti
P74932        91 VIFTTFSAAGQFFSYQMGFGTSEMYDTFAQIENPLMGQFLNFVAMLVFLQIKGFQILFLgGVLRSFQAVNCFVFLRKQe- 169 Treponema palli...
AAC32324      97 ILFSAAALAGDRIASTAGLGFAAQIDPSAGGQTPVVAQIFGLALTTVFLALDGHLTALD-ILLRSYESLPPGAPFAPG-- 173 Rhodobacter sph...
O67773        88 LLFDALIIAGELIALHTGLGFLQMFIPG-MTQMSLFSGFFTLYGTLIFLSLGGGEFIIL-GLAESFKRLPVGSFNIFY-- 163 Aquifex aeolicu...
Q44907        93 IIFNVFHLVGFFFSNQIGLAYANIFDVFSEEDSMIISQIFAYLFLLLFLSSDFLLRFFViGIHDSVLNIRVEHLVNMRn- 171 Borrelia burgdo...
WP_000883720  90 IVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLLAILILLDLSFHHQIIL-FVDHSLKAVPLGQFVFEP-- 166 Helicobacter py...
WP_010898593  84 VLLYAIQAAGAFIDVKIGFLIANIVDPQTGAQSPLIGSYLYTFALLFMLATNGHHLLID-GMYYSYQFIPLNQPFLNVsd 162 Bacillus halodu...
WP_004080654  90 LFLQAFNGAGYIFGFQIGFGMEEVLAFG-EEETNPTGELVYFIALTVFVLIKGPVLLFE-GLKDSIDVFPVNLTGVTD-- 165 Thermotoga
WP_002878542  88 IIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQILNLLALMFFLAFDGHHLMLL-FLSHSLGYISLGGFYPHE-- 164 Campylobacter j...
WP_010895936  90 LLFATINLSGEIIGLQMGLSFATFFNNNSQIGTSIISRFLNILALFVFITLNMHLYLIS-IVIDSFYSMPIDGYFLNV-- 166 Buchnera aphidi...
WP_010911311  89 LYMEALRFMGSAIAMLIGYGGSGGPAIEEPEPQAALAAIISFSALLMLFVFDFDHEIVR-ALVASYTVAPVNVFFNPQ-- 165 Mesorhizobium loti
P74932       170 -ALLLFFTKALSALFLHAMTIALPIMGALLLIHVSMGLLTKAAPQMNLLSEGLPLTIVVTFVLLSVILPYMINLFVSILF 248 Treponema palli...
AAC32324     174 -RFLEAGIGAGGRMFLLGLQIMMPVVAALILINVTIGIVTRSAPQLNVFSFGFPVTMSATLILLFLTAPGTMGAFSGLVE 252 Rhodobacter sph...
O67773       164 -LNPEVFLNFFYESFRLGVKIAMPLILTALILNLVLAVVNRFIPQMNVFMVGLPLQVSIGLIILLLSLPLITITMSNHFQ 242 Aquifex aeolicu...
Q44907       172 sGFVKLLLMSFGFLFEKALLISFPILSLLLLFYLVLGILSKSSPQINLLIISFSTSLFLGLLILYIGFPSLAISSKRVIE 251 Borrelia burgdo...
WP_000883720 167 -ALAKNIVKAFSHLFVIGFSMAFPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEIS 245 Helicobacter py...
WP_010898593 163 eNMIELIATTLNTMFIIAFQMAFPLVGSLFLVDVALGMVSRAVPQMNVFVVGMPLKILVGLPLLMIFMGVFFMSVSYLFE 242 Bacillus halodu...
WP_004080654 166 -GFFSYIVGRSSDFFVLILKIGAPVIAFMLIISIVLGIVSRLIPQMNVFMVGLPLKVIIGVILILGMLPIWADMAQKISA 244 Thermotoga
WP_002878542 165 -NLMHYLNMGMFNIFIIGFTMSFPILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLIL 243 Campylobacter j...
WP_010895936 167 -NIFFILLKFSSSIFLNGLLLVLPIMIILLSISFVMSLLNRLSPQISIFSIGFPLNLILGMLMLYFLIPVMLPFLKKILD 245 Buchnera aphidi...
WP_010911311 166 -AALVDITDTVSDTFFLVIRLGSPFVAYAILVNLTIGFVNKLTPQIPIYFISQPFVIAGGMIIFYFAIGTMLSLFVDGFV 244 Mesorhizobium loti
P74932       249 GGFEMFEQLL 258 Treponema pallidum subsp. pallidum str. Nichols
AAC32324     253 ESLTALAGLL 262 Rhodobacter sphaeroides
O67773       243 DFFKVFEYFI 252 Aquifex aeolicus VF5
Q44907       252 LSLDSLASFL 261 Borrelia burgdorferi B31
WP_000883720 246 LAFSAISKIF 255 Helicobacter pylori
WP_010898593 243 RMLETMRAMM 252 Bacillus halodurans
WP_004080654 245 LSWNAIQELL 254 Thermotoga
WP_002878542 244 ELFTHMQTLF 253 Campylobacter jejuni
WP_010895936 246 DLIFFMNNNL 255 Buchnera aphidicola
WP_010911311 245 DLTLAR---- 250 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap