Conserved Protein Domain Family
fliM_switch

?
TIGR01397: fliM_switch 
flagellar motor switch protein FliM
Members of this family are the flagellar motor switch protein FliM. The family excludes FliM homologs that lack an N-terminal region critical to interaction with phosphorylated CheY. One set lacking this N-terminal region is found in Rhizobium meliloti, in which the direction of flagellar rotation is not reversible (i.e. the FliM homolog does not act to reverse the motor direction), and in related species. Another is found in Buchnera, an obligate intracellular endosymbiont with genes for many of the components of the flagellar apparatus, but not, apparently, for flagellin iself. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 130464
View PSSM: TIGR01397
Aligned: 9 rows
Threshold Bit Score: 372.809
Threshold Setting Gi: 501787109
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD15907       3 DLLSQDEIDALLHGVDDVd------DIDEP-L--DNDTEG-AVSFDFSSQDRIVRGRMPTLELINERFARHMRISLFNML 72  Vibrio parahaem...
P06974         4 SILSQAEIDALLNGDSEVk------DEPTA-S--VSGESD-IRPYDPNTQRRVVRERLQALEIINERFARHFRMGLFNLL 73  Escherichia col...
AAD20622       3 EVLSQDEIDQLLTAISSGd-----tDTEDFrA--VNDTRK-IKIYDFKRPDKFSKEQMRTVQMMHETFARLTTTSLSAQL 74  Treponema denti...
CAA74715       6 RKLSSKEVAALVGNLMEAs------ESTS-----LENGLE-VRPYAFGENELNQLGDYHALRIINERFCRTARDVFLPML 73  Rhodobacter sph...
WP_010898599   3 DVLSQGEIDALLSALSTGe-----mDADELkK--EELEKK-VKVYDFKRALRFSKDQIRSISRIHENFARLLTTYFSAQL 74  Bacillus halodu...
WP_011715109   3 QILSTDEIDALMMGLEEGtidldeiDEDMPsA--SKDEKK-TTPFTFGQKTAIRVGALPGLDLINEHLASQLSFKLTQKV 79  Magnetococcus m...
WP_004081085   3 DVLSQEEINQLIEALMKGe------LKEEDlL--KEEEEKkVKPYDFKRPSKFSKEQLRTFQMIHENFGRALSTYLSGRL 74  Thermotoga
WP_000763575   3 DILSQEEIDALLEVVDENv------DIQNVqKkdIIPQRS-VTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIM 75  Helicobacter py...
WP_012640397  50 RILNQDEIDSLLGFDLSGd------GSDD----------R-TGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFT 112 Caulobacter vib...
AAD15907      73 RKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAk-iEGREFTPTERR 151 Vibrio parahaem...
P06974        74 RRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTk-vEGREFTHTEQR 152 Escherichia col...
AAD20622      75 RSMAHVHVATVEQLTYEEFIRSIPTPTTLAIINMDPLRASALLEIDPSVTFSIIDRLFGGKGQGSK---VQRELTEIESS 151 Treponema denti...
CAA74715      74 RLQPRISSFPPEVRSFDDYRSSQDNFVSITASRIEELRGNQMIVIPPPFISLLTDSYYGGQIRHVPt--TRTEFTATEER 151 Rhodobacter sph...
WP_010898599  75 RTFVQISVASVDQLPYEEFIRSIPKMTILNVFEPAPLDGRFLIEVNPNVAYAMLDRLLGGQGVSVN---KVDNLTEIETR 151 Bacillus halodu...
WP_011715109  80 GREVHVQPKTTTNQVFGRFLHTVEPPIFINILRVEPSQSMALISIDGDVMYTVLEGFFGGPGDSER---PFRNFSPFEMK 156 Magnetococcus m...
WP_004081085  75 RTFVDVEI-SIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPP----NRPPTEIETS 149 Thermotoga
WP_000763575  76 RSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYD---QNREFSDIELN 152 Helicobacter py...
WP_012640397 113 SDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAAmriEGRPYTTIERV 192 Caulobacter vib...
AAD15907     152 IIQLLLKIVFEDYKEAWSPVMG-VEFEYLDSEVNPSMANIVS-PTEVIVVSSFHIEVDGGG-GDFHVVMPYSMVEPIREL 228 Vibrio parahaem...
P06974       153 VINRMLKLALEGYSDAWKAINP-LEVEYVRSEMQVKFTNITTsPNDIVVNTPFHVEIGNLT-GEFNICLPFSMIEPLREL 230 Escherichia col...
AAD20622     152 VMEGVIVRILANMREAWTTVVD-LRPRLGNIDTNPQFVQIVT-PSEMVLLVTLETKVGEEE-GMMNICLPYITLEPIISK 228 Treponema denti...
CAA74715     152 CIELVTDRLNVALQVAWRDLMA-LTFTVVSREESMQFASFVD-GEDMVVNCSFMVQLPNTEpASFDILYPLQTLKPISSQ 229 Rhodobacter sph...
WP_010898599 152 IMSQLFQRTLDSFQEAWSTVIE-LEPEMDAVEVNPQFLQMVS-PNETVVVISLSTTIAETS-GMINICLPHVVLEEVLPK 228 Bacillus halodu...
WP_011715109 157 VIDRIMDVAREQIELSWKKLDPsFRLVLARWENQPQFAAVMP-LDETVFLITFSVEVGDAE-GNITICFPAVILELFKQQ 234 Magnetococcus m...
WP_004081085 150 IMRKEVTNMLTLLAQAWSDFQY-FIPSIENVETNPQFVQIVP-PNEIVLLVTASVSWGEFT-SFINVCWPFSLLEPLLEK 226 Thermotoga
WP_000763575 153 LLDTILRQVMQILKEVWSPVVE-MFPTIDAKESSANVVQIVA-QNEISIMVVLEIIIGHSR-GMMNICYPVISIESILSK 229 Helicobacter py...
WP_012640397 193 LVQRMIEVVLHDLKSAFEPLHP-VSFSLDRLETNPRFAAIAR-PANAAILVKLRIDMEDRG-GRIELLLPYATLEPIRKM 269 Caulobacter vib...
AAD15907     229 LDAG--VQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDIIPIE---MPEHATMFIEDLPTYRVK 303 Vibrio parahaem...
P06974       231 LVNP--PLENSRNEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLNPGDVLPIE---KPDRIIAHVDGVPVLTSQ 305 Escherichia col...
AAD20622     229 LSTQfwFSSVRRASTGQYAAAIKDKLSTVEVDMVAEVGSLDVSIRDVLNLRAGDVVRLPnvrVGDPFKLTVGSRPKFSCQ 308 Treponema denti...
CAA74715     230 LRSR--MQSDFVDDDRSWREKLERAILSIPLTLSARLCEPEVPLRQLMQMQPGDVLPVH---LTEALSLLVEGQPIFEAA 304 Rhodobacter sph...
WP_010898599 229 LSVHywMQEKKKQRQPGELDSIEHRVRQAPLLIQTELGRSEITIHEFLHLGIGDVIELDq-sIHEPLNVRVGGHLKYLAQ 307 Bacillus halodu...
WP_011715109 235 LKQGf-QQKEEVEGASAWMDALKNELSLVRVDMTPVMGTVEMSVEQMLNLKVGDEFILGt-dMSEEMAVQIGGMDKFMCH 312 Magnetococcus m...
WP_004081085 227 LSDRfwMMGRKPEKVEERMEELRKASQKIPVTVQAVIGETELRLKEILDLEVGDVIRLGt-hYKDEIRIDVEGRPKFRGI 305 Thermotoga
WP_000763575 230 MGSRdlMLSETNSKKS-RNKELQALLSGVSVDMIVFLGAVELSLKEMLDLDVGDTIRLNk-iANDEVSVYVHKKKRYLAS 307 Helicobacter py...
WP_012640397 270 LLQQf-M-GEKFGRDNIWEGHLATELWTTQMEVRAVLDEQQVPLSRVLNMQVGDTLMLNa-tPDSLVELRAGAIPLTRGR 346 Caulobacter vib...
AAD15907     304 MGRSEDKLAVQVSQEIE 320 Vibrio parahaemolyticus
P06974       306 YGTLNGQYALRIEHLIN 322 Escherichia coli K-12
AAD20622     309 PGVKGKKLAVQILEKIE 325 Treponema denticola
CAA74715     305 PGERGGQAALNLTRRHV 321 Rhodobacter sphaeroides
WP_010898599 308 PGKKKNHLAVQVTDVIE 324 Bacillus halodurans
WP_011715109 313 AGVVDGKRAIRITRTVQ 329 Magnetococcus marinus
WP_004081085 306 PGVFKGKYAVKVTGEFT 322 Thermotoga
WP_000763575 308 VGFQGYRKTIQIKEVIY 324 Helicobacter pylori
WP_012640397 347 MGRRNHSIAVRAEAPLT 363 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap