2YWE


Conserved Protein Domain Family
lepA

?
TIGR01393: lepA 
Click on image for an interactive view with Cn3D
elongation factor 4
LepA (GUF1 in Saccaromyces), now called elongation factor 4, is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 130460
View PSSM: TIGR01393
Aligned: 15 rows
Threshold Bit Score: 1066.56
Threshold Setting Gi: 24211968
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YWE_A         4 KNVRNFCIIAHVDHGKSTLADRLLEYTGAISEREKREQLLDTLDVERERGITVKMQAVRMFYK-AKDG--NTYKLHLIDT 80  Aquifex aeolicu...
Q9X1V8        21 DLIRNICIIAHIDHGKTTLVDRILEITNTVDRRKMREQYLDMMDIERERGITIKAQPVKVMYT-AEDG--NTYEINIIDT 97  Thermotoga mari...
CAB73286       4 KNIRNFSIIAHIDHGKSTLADRIISECGAISDRQMSSQVMDTMDIEKERGITIKAQSVRLNYK-FN-N--ENFVLNLIDT 79  Campylobacter j...
Q9RV84        12 SQIRNFSIIAHVDHGKSTLADRILEQLGAMGERDKRDQTLDTLELERERGITIKSTPIRLEYTr-ENG--EGYVFNLIDT 88  Deinococcus rad...
P53530        42 AQIRNFCIIAHIDHGKSTLADRMLQLTGVVDERSMRAQYLDRMDIERERGITIKAQNVRLSWSvTAGGttENYVLHLIDT 121 Mycobacterium l...
O51115        10 IRKKNFCIIAHIDHGKSTLADRFIQKAKIISDRDFKSQMLDSMDIERERGITIKSQAVTITYK-SNDG--DFYELNFVDT 86  Borrelia burgdo...
O83523         8 RRVRNFCIVAHIDHGKSTLADRLIERTRAVEERLQHAQMTDNMELERERGITIKSHAVCIPYT-DAHG--TEYVLNFVDT 84  Treponema palli...
WP_011712581   4 DHIRNFSIIAHIDHGKSTLADRLIQFTGALSERDMKEQVLDSMDIERERGITIKAQSVRLNYK-AKDG--KTYVLNLIDT 80  Magnetococcus m...
WP_005722312   2 KNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMDLERERGITIKAQSVTLNYK-AKDG--ETYQLNFIDT 78  Pasteurella mul...
WP_006688644   4 KFIRNFSIIAHIDHGKSTLSDRIIEFTNTLSKREMTNQILDSMDIERERGITIKLNAVQIKYH-AKDK--HEYLIHLIDT 80  Ureaplasma parvum
2YWE_A        81 PGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINKIDLPSADVDRVKKQIEEVLGLDPEEA 160 Aquifex aeolicu...
Q9X1V8        98 PGHVDFSYEVGRSMAACEGAILLVDATQGVEAQTVAHTYLAIEHDLEIIPVINKIDLPNANIEETALEIKDLLGVSENEI 177 Thermotoga mari...
CAB73286      80 PGHVDFSYEVSRSLASCEGALLVVDASQGVEAQTIANVYIALENNLEIIPVINKIDLPNADVEKVKHEIEHIIGIDCKDA 159 Campylobacter j...
Q9RV84        89 PGHVDFNYEVSRSLAACEGVLLLVDASQGVEAQTIVNAYLAIDNNLEIVPVINKIDLPAADPEGAARELEEVIGIPAEDA 168 Deinococcus rad...
P53530       122 PGHVDFTYEVSRALEACEGAVLLVDAVQGIEAQTLANLYLALERDLTIIPVLNKIDLPAADPDRYAAEIAHIIGYESGDV 201 Mycobacterium l...
O51115        87 PGHVDFSYEVSRAISSCEGALLLIDASQGIQAQTVSNFYMAFEHDLEIIPVINKIDLPNANVDFVKKQIKNDLGLNEEIA 166 Borrelia burgdo...
O83523        85 PGHADFAYEVSRAIAACEGALLVVDATQGVESQTISNLYLVLEHNLEIIPVINKIDLPTADVPRVLQQVEHDLGLDPASS 164 Treponema palli...
WP_011712581  81 PGHVDFTYEVSRSLAACEGALLIVDAAQGVEAQTMANVYLALEHDLEIIPVLNKIDLPSAEPERVREQIEEVIGLDASEA 160 Magnetococcus m...
WP_005722312  79 PGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEA 158 Pasteurella mul...
WP_006688644  81 PGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLSNVYLALENNLEIVPTINKIDLPSADPNRVKKEIEDVIGLDTADV 160 Ureaplasma parvum
2YWE_A       161 ILASAKEGIGIEEILEAIVNRIPPPKGD-PQKPLKALIFDSYYDPYRGAVAFVRIFDGEVKPGDKIMLMSTGKEYEVTEV 239 Aquifex aeolicu...
Q9X1V8       178 LLVSAKEGTGVKELLEAIVKRVPPPKGD-INGKLKALIFDAKYDNYKGVIVHVRLFDGQVKPGDKIMTFSNKKVYEVQEV 256 Thermotoga mari...
CAB73286     160 ICVSAKTGVGIKELIETIITKIPAPKTD-DEAPTKALIYDSWFDNYLGALALVRIYEGSIAKNDEVLVMSTDKKHIVQDL 238 Campylobacter j...
Q9RV84       169 VRASGKTGIGIPEILEAVVERIPPPAGD-PGAPLKALIFDSFFDAYQGVILFVRVLEGTMKAKDGVRLMNAGKNFEVDKV 247 Deinococcus rad...
P53530       202 LRVSGKTGEGVSDLLDEVVRRVPHPQGD-PDAPTRAMIFDSVYDIYRGVVTYVRVVDGKISPRERIAMMSTGATYELLEV 280 Mycobacterium l...
O51115       167 ISISAKNGIGIDDLLEAICKYVPSPRGS-IKDPLRALIFDSHYDSYRGVVVHFRIFEGQIKMGDKIRLMHTNSEHLIEEI 245 Borrelia burgdo...
O83523       165 VLISAKTGENVDALFDAIITRIPPPQGS-GTAALQALVFDCHYDQYRGVVVHIRVFEGQVTSGMVIRFMSNGAEYRVEET 243 Treponema palli...
WP_011712581 161 ILASAKSGIGIEEILEAIVKRVPPPKGD-LDAPAKALVVDSWYDNYLGVVSLARVYDGVLKAGEKIRFMGVGMDYPLDNV 239 Magnetococcus m...
WP_005722312 159 VRCSAKTGVGIEDVLEEIVHKIPAPEGD-PNAPLQALIIDSWFDNYLGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVDRL 237 Pasteurella mul...
WP_006688644 161 PLISAKTGLNIQDVLEAIIKHVPPPLDAkDDAKLQALIFDSFYDSYKGVVCLVRVKQGTIKVGDKIRMMANNKDYIVSEL 240 Ureaplasma parvum
2YWE_A       240 GAQTPKM-TKFDKLSAGDVGYIAASIKDVRDIRIGDTITHAKNPTKEPVPGFQPAKPMVYAGIYPAEDTTYEELRDALEK 318 Aquifex aeolicu...
Q9X1V8       257 GVFLPEM-EPVDSLSAGEVGYIIAGIKEVSDARVGDTITSANDPVDEALPGYREIKPMVFAGMFPGLPEYYEELRKALEK 335 Thermotoga mari...
CAB73286     239 FYPHPLSpIKTQSLQSGEVGVVVLGLKTVGDVQVGDTITLVKNKAKEAIGGFEKAKAFVFAGLYPIETDKFEDLRDALDK 318 Campylobacter j...
Q9RV84       248 GTFSPGL-VVGQELSAGMVGWVAAGIKDIQDAQVGDTLTGSDRQTAEPFPGFKPAQPVVFSGLYPTDTEDYRKLRDALEK 326 Deinococcus rad...
P53530       281 GIVSPEP-KASAGLGVGEVGYLITGVKDVRQSKVGDTVTTVRYGATEPLTGYREPKPMVYSGLYPVDSSDYPSLRDALGK 359 Mycobacterium l...
O51115       246 GIFKISLeRKD-TLEAGDVGYFIAGIKNISDVKIGDTVTLCDFPALSPLEGFKEVKPVVFSSVYPVDANQYDDLLKAMDR 324 Borrelia burgdo...
O83523       244 GVFVFNLiARE-ALCAGDVGYLSANVKTVSDVQVGDTITDASCPCDTPRAGFRRVKPVVFSSVYPVDTDECEQLREALER 322 Treponema palli...
WP_011712581 240 GFLTPVL-TKVAELKAGEVGCIMAGIKKLSDARVGDTITTVRRPCASQLPGFQPAKSMVFAGLYPVDSADYEDLKDALEK 318 Magnetococcus m...
WP_005722312 238 GIFTPKQ-VDTTILNCGEVGWVVCAIKDILGAPVGDTLTSHNNPASSVLPGFKKVKPQVYAGLFPISSDDYEAFRDALGK 316 Pasteurella mul...
WP_006688644 241 GIRTPKI-VNKTELVAGEVGWVAAAIKTVKDINVGDTITHTNNPADKPLPGYKKILPMVYCGLYPIDTSQYDDLKEAMAK 319 Ureaplasma parvum
2YWE_A       319 YAINDAAIVYEPESSPALGMGFRVGFLGLLHMEIVQERLEREYGVKIITTAPNVIYRVKKKfTDEVIEVRNPMDFPDNaG 398 Aquifex aeolicu...
Q9X1V8       336 LKLNDSALYFEPTMSPAMGFGFRCGFLGPLHMEVVRERIEREFDLAVILTAPNVRYRVKLR-NGEEIEITDPSKFPDE-G 413 Thermotoga mari...
CAB73286     319 LKLNDSSITYEPETSLALGFGFRVGFLGLLHMEVIKERLEREFNLDLIATAPTVTYEIYQT-DGELIKIQNPSELPPV-N 396 Campylobacter j...
Q9RV84       327 LKLNDAAFSFEPETSEALGFGFRCGFLGLLHAEIIQERLEREYDLDLIATAPAVVYRVTLT-NGEIFETQNPAEFPTR-D 404 Deinococcus rad...
P53530       360 LQLNDAALTYEPETSVALGVGYRCGFLGLLHIDITRERLEREFDLDLISTSPNVVYRVVTE-DNTEIVVTNPSDWPE--G 436 Mycobacterium l...
O51115       325 LKLNDASLTFEKDSSSALGHGFKCGFLGLLHLEVIQERIEREFNLNVILTSPSVRYKIIPK-KGESYFIETPEQFPGN-E 402 Borrelia burgdo...
O83523       323 LALNDASISWERDSSLALGHGFRCGFLGLLHLEVVQQRLEREFNQTVIFTAPQVQYYVFLK-TGQRIVCDNPAHYPLE-Q 400 Treponema palli...
WP_011712581 319 LAINDASLNYEVETSPALGFGFRCGFLGMLHMEIIQERLEREFDLDLVTTAPTVVYRVKQT-DGQIMDIRSPGDLPPT-T 396 Magnetococcus m...
WP_005722312 317 LSLNDASLFYEPENSTALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVEKT-DGEVIYVDSPSKLPPL-N 394 Pasteurella mul...
WP_006688644 320 ISLSDAALTYEYETSQALGFGIRCGFLGLLHMDVIRERIAREFNIELILTAPSVIYKIELT-NNQEISIDSPAKMPEP-T 397 Ureaplasma parvum
2YWE_A       399 LIEYVEEPFVLVTIITPKEYVGPIIQLCQ-EKRGIQKNMTYLDPNTVYLEYEMPLSEIIVDFHDKIKSISRGFASYDYEF 477 Aquifex aeolicu...
Q9X1V8       414 EILEAYEPYVDLSIITPSEYIGAIINLVQnEKRGELRITENAGKNRVILRFDAPLAEIIYDFFDRMKAVSRGYASMDYEF 493 Thermotoga mari...
CAB73286     397 KIDHIKEPYVKATIITPSEFLGNLITLLN-RKRGVQVKMDYITPERVLLEYDVPLNEIVMDFYDKLKSLTKGYASFDYEP 475 Campylobacter j...
Q9RV84       405 RIEKVEEPYIKLSVMLPEDYVGPVMQLLQ-ERRGSMQTMNYVGK-RVELVYEVPFAEILYDFHDRLKSISRGYASMDYEQ 482 Deinococcus rad...
P53530       437 KIRTVYEPVVKITIIAPSEFIGTIMELCQ-SRRGELGGMDYLSPERVELRYIMPLGEIIFDFFDSLKSRTRGYASLDYEE 515 Mycobacterium l...
O51115       403 AIESVLEPYIKANIIVPTEFLGNIMSVCL-LKRGVQTNLIYLDTKRVELIYKMPLSEILFDFYDKIKSVSRGYASFDYEL 481 Borrelia burgdo...
O83523       401 EIAQVHEPYIRATIITPTEVLGAVMTLCI-EKRAYQTAVNYLDQKRVELVYEMPLAEILFGFYDRLKSISHGYASFDYEL 479 Treponema palli...
WP_011712581 397 KREYIEEPYILANIMVPAEYMGPVMQLCT-DRRGTQKDMSYISDTRVMVQYEMPMSEVVMDFFDRLKSMTKGYASLDYHL 475 Magnetococcus m...
WP_005722312 395 NITEIREPIAECNMLLPQTYLGNVITLCV-EKRGVQTNMVYHG-NQVALTYEIPMGEVVLDFFDRLKSTSRGYASLDYGF 472 Pasteurella mul...
WP_006688644 398 SIKLIKEPFVKLAIITPDNYVGAIMELCQ-SRRGIYDDLEVIDGTRRKLIYKMPLAEIMYSFFDSLKSITKGYATMDYEL 476 Ureaplasma parvum
2YWE_A       478 IGYRPSDLIKLTVLINKKPVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLRANVTAK 557 Aquifex aeolicu...
Q9X1V8       494 KEYRRSDLVKVTILVNKEPVDALSFIVHRSKAYQMARKIVEKLKDLIPRHQFQIPIQAKAGGRIIARADIKALRKDVLAK 573 Thermotoga mari...
CAB73286     476 IEFRVGDLVKLDIKVAGENVDALSIIVPNEKAQSKGRELVSAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAK 555 Campylobacter j...
Q9RV84       483 LGYREGDLRKVDIMVNNEVIDALAVIVHESKTYSLGRKIVDKMAEVIPRQMFPVPVQAVIGAKIIARATVKAYRKDVLAK 562 Deinococcus rad...
P53530       516 AGEQEAQLVKVDILLQGEAVDAFSAIVHKDSASAYGNKMTNKLKELIPRQQFEVPVQAAIGSKVIARENIRAIRKDVLSK 595 Mycobacterium l...
O51115       482 LDYEYTDLVRLDILVNGDRVDALSQLVFKDSARTKAIGICKKLKDEIARQQFRIAIQGAIGSNVIARETISPVRKDVTAK 561 Borrelia burgdo...
O83523       480 IESKLTDLVKVDILINGKPVDALAQLCYRPHARRRAQAVCARLKEEISRQQFKIAIQGSIGGQIISRETVSPFRKDVLAK 559 Treponema palli...
WP_011712581 476 LDYRMSDLVKLDILINGDPVDALSVIVHRNISQYRGRELAKKMKELIHRQMFDVAVQACIGGKIIARETVKALRKNVTAK 555 Magnetococcus m...
WP_005722312 473 KRFQAADMVRVDIMINGERVDALALIVHKDNAPYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAK 552 Pasteurella mul...
WP_006688644 477 IGYQAEKLVKIDIMLNGNKVDALSIIAHRDFAYGKSKIICERLKEVIPKHQFEIPIQASIGSKIIARETIKAVRKDVIAK 556 Ureaplasma parvum
2YWE_A       558 CYGGDVTRKKKLLENQKEGKKRMKQFGKVQLPQEAFLSVLKVE 600 Aquifex aeolicus VF5
Q9X1V8       574 CYGGDVTRKMKLLEKQKEGKKKLREIGRVTIPQEAFLALLKIG 616 Thermotoga maritima MSB8
CAB73286     556 CYGGDITRKRKLLEKQKEGKKRMKAIGKVNLPQEAFLSVLKID 598 Campylobacter jejuni subsp. jejuni NCTC 11168
Q9RV84       563 CYGGDISRKKKLLEKQKKGRARMKQFGTVEVPQEAFLAVLSTE 605 Deinococcus radiodurans R1
P53530       596 CYGGDITRKRKLLEKQKEGKKRMKTIGRVEVPQEAFVAALSAD 638 Mycobacterium leprae TN
O51115       562 CYGGDITRKRKLLEKQKEGKKRMKMVGNVEIPQSAFLAVLKSN 604 Borrelia burgdorferi B31
O83523       560 CYGGDITRKRKLLEKQKEGKKRMKMVGDVEIPQTAFLSVLKEA 602 Treponema pallidum subsp. pallidum str. Nichols
WP_011712581 556 CYGGDITRKRKLLEKQKAGKKRMKQVGKVEIPQEAFLAVLKVD 598 Magnetococcus marinus
WP_005722312 553 CYGGDVSRKKKLLQKQKEGKKRMKSLGNVEVPQEAFLAILHVG 595 Pasteurella multocida
WP_006688644 557 CYGGDVSRKKKLLEQQKEGKKRLKAIGNVDVPQDAFVKVLSEN 599 Ureaplasma parvum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap