Conserved Protein Domain Family

TIGR01393: lepA 
Click on image for an interactive view with Cn3D
elongation factor 4
LepA (GUF1 in Saccaromyces), now called elongation factor 4, is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown. [Unknown function, General]
PSSM-Id: 130460
Aligned: 15 rows
Threshold Bit Score: 1066.56
Threshold Setting Gi: 24211968
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAB73286     556 CYGGDITRKRKLLEKQKEGKKRMKAIGKVNLPQEAFLSVLKID 598 Campylobacter jejuni subsp. jejuni NCTC 11168
O83523       560 CYGGDITRKRKLLEKQKEGKKRMKMVGDVEIPQTAFLSVLKEA 602 Treponema pallidum subsp. pallidum str. Nichols
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap