Conserved Protein Domain Family
CycNucDiestase

?
TIGR01390: CycNucDiestase 
2',3'-cyclic-nucleotide 2'-phosphodiesterase
2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 130457
View PSSM: TIGR01390
Aligned: 4 rows
Threshold Bit Score: 1026.35
Threshold Setting Gi: 499190831
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08331        22 VDLRIMETTDLHSNMMDFDYYKDTATEKFGLVRTASLINDARNEVKNSVLVDNGDLIQGSPLADYMS-AKGLKAGDIHPV 100 Escherichia col...
P44764        32 VDLRIVATTDVHSFLTDFDYYKDAPTDKFGFTRAASLIRQARAEVKNSVLVDNGDLIQGNPIADYQA-AQGYKEGKSNPA 110 Haemophilus inf...
WP_001894677  56 IKLRIVETTDIHTNLMDYDYYKDKASDQIGLTRAATLVKQARAEVENSVLVDNGDLIQGSPMGDYMA-AKGIKAGEVHPV 134 Vibrio cholerae
WP_010888371  64 VDLRILETTDLHTNALGYDYYQDKPTGEFGLEYTATLLKQAREEKRNTLLYDNGDLIQGTPLGDYVArVQPLRAGQMHPL 143 Deinococcus rad...
P08331       101 YKALNTLDYTVGTLGNHEFNYGLDYLKNALAGAKFPYVNAN-VIDARTKQP---MFTPYLIKDTEVVDKDGKKQTLKIGY 176 Escherichia col...
P44764       111 IDCLNAMNYEVGTLGNHEFNYGLNYLADAIKQAKFPIVNSN-VVKAGTEEP---YFTPYVIQEKSVVDNQGKTHKLKIGY 186 Haemophilus inf...
WP_001894677 135 YKAMNPLGYDVGNIGNHEFNYGLEFLKETINDAAFPYINAN-VFDAKTGQH---LFTPYVIKEHSFKDTDGEAHTIKVGY 210 Vibrio cholerae
WP_010888371 144 HAAMRLLKYDAANLGNHEFNYGLPFLQQVVAAAPMPIVSANtYVDDGNGKPganAFTPYLIQRRTVYDTEGRPYILNVGV 223 Deinococcus rad...
P08331       177 IGVVPPQIMGWDKANLSGKVTVNDITETVRKYVPEMREKGADVVVVLAHSGLSADPYKVMAENSVYYLSEIPGVNAIMFG 256 Escherichia col...
P44764       187 IGFVPPQIMVWDKANLQGKVETRDIVKTAQKYVPEMKKKGADIVVALAHTGPSDEPYQEGAENSAFYLADVPHIDAVIFG 266 Haemophilus inf...
WP_001894677 211 IGFVPPQIMVWDKKNLEGKVTAADIKQTAEKLIPEMKAKGADVIVAIPHSGISTDEYQAGAENSVYYLTQVKGIDAIAFG 290 Vibrio cholerae
WP_010888371 224 IGLLTPQIVQWDKSNLDGKIVTADIVDTARKFVPEMKAAGADIIVAVAHSGINAD-YQPGQENVATELTKVPGIDVVLSG 302 Deinococcus rad...
P08331       257 HAHAVFPGKDFADIEGADIAKGTLNGVPAVMPGMWGDHLGVVDLQLSND--SGKWQVTQAKAEARPIYDIANKKSLAAED 334 Escherichia col...
P44764       267 HSHRLFPNKEFAKSPNADIVNGTVKGIPESMAGYWANNISVVDLGLTEH--KGKWIVTSGKAVLRPIYDIETKKALAKND 344 Haemophilus inf...
WP_001894677 291 HSHAVFPGKDFANVPGADIDKGTINGVTAVMPGRWGSHVGVMDLTLEKQ--QGRWAVTSGQSEARPIFDKANKKALVEAD 368 Vibrio cholerae
WP_010888371 303 HSHQEFPGPVYKTIPGADITNGTINGKPVVMAGYWGNDLGVVDLQLNYDrkSQTWTIQNAKTSLRPIWDKTAKKSLVTPD 382 Deinococcus rad...
P08331       335 SKLVETLKADHDATRQFVSKPIGKSADNMYSYLALVQDDPTVQVVNNAQKAYVEHYIQGDPDLAKLPVLSAAAPFKVGGR 414 Escherichia col...
P44764       345 PEITALLKPVHEATRKYVSQPIGKATDNMYSYLALLQDDPTIQIVNQAQKAYVEKVAPSIAAMAGLPILSAGAPFKAGGR 424 Haemophilus inf...
WP_001894677 369 ATMVQALQHDHQGTRDFVNQPIGKANDVMYSFLSLVQDDPTVQIVNLAQKDYVERFIQGDPNLDGLPVLSAAAPFKAGGR 448 Vibrio cholerae
WP_010888371 383 PAIARAVKAAHEGTLRYVRGKVADLAAPVTSYWALVQDDPSVQLVSNAQTAYVKAALAS-TQYKDLPVLSAAAPFKAGGR 461 Deinococcus rad...
P08331       415 KNDPASYVEVEKGQLTFRNAADLYLYPNTLIVVKASGKEVKEWLECSAGQFNQIDPNSTKPQSLINWDGFRTYNFDVIDG 494 Escherichia col...
P44764       425 KNDPTGYTEVNKGKLTFRNAADLYLYPNTLVVVKATGEQLKEWLECSAGMFKQIDPTSDKPQSLIDWEGFRTYNFDVIDG 504 Haemophilus inf...
WP_001894677 449 KDDPNGFTEVEAGELTFRNAADLYLYPNTLVTMKVSGQQLKEWLECSAGQFNQIDVTSSAPQSLINWDGFRTYNFDVIDG 528 Vibrio cholerae
WP_010888371 462 -GGVSYYTDIPAGTLAIKNVADLYVYPNTVQAVLVTGAQVQEWLERAAGQFKQIDPSKTEPQALVD-DSFPTYNFDILDG 539 Deinococcus rad...
P08331       495 VNYQIDVTQPARYDGECQMINANAERIKNLTFNGKPIDPNAMFLVATNNYRAYGG-KFAGTGDSHIAFASPDENRSVLAA 573 Escherichia col...
P44764       505 VNYEYDLTKPARYDGECKLINPESHRVVNLTYQGKPVDPKAEFLIATNNYRAYGN-KFPGTGDKHIVYASPDESRQILAD 583 Haemophilus inf...
WP_001894677 529 VNYQIDVTQPARYDGDCKLINPNSQRIVQLTYQGKPIDTQQTFLIATNNYRAYSN-KFPGTGAEFVAFDSPDENRTVVAD 607 Vibrio cholerae
WP_010888371 540 VTYEIDVTQPSRYGSDGKVANEGAHRIKNLMYGGKPIDPAAQFVVATNNYRASGGgKFPGLDGKNIILQAPDETRQALIA 619 Deinococcus rad...
P08331       574 WIADESKRAGEIHPAADNNWRLAPIAGDKKLDIRFETSPSDKAAAFIKEKGQYPMNKVATDDIGFAIYQVDLSK 647 Escherichia coli K-12
P44764       584 YIKATSEKEGSVNPNADKNWRFVPITGNDKLDVRFETSPSEQAAKFIAEKAQYPMKQVGTDEIGFAVYQIDLSK 657 Haemophilus influenza...
WP_001894677 608 YIARVSKDKGEVTPSADNNWSFAPISSKTKLDIRFETSPSDKATQFIKQKGQYPMTRVASDDVGFAVYRIDLQK 681 Vibrio cholerae
WP_010888371 620 YFQDQK----TVNPAADGNWKLTPIPG-VTLSVvsspngqknlpagvtyvqtrddgfaeynlkf---------- 678 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap