1YT3


Conserved Protein Domain Family
rnd

?
TIGR01388: rnd 
Click on image for an interactive view with Cn3D
ribonuclease D
This model describes ribonuclease D, a 3'-exonuclease shown to act on tRNA both in vitro and when overexpressed in vivo. Trusted members of this family are restricted to the Proteobacteria; Aquifex, Mycobacterial, and eukaryotic homologs are not full-length homologs. Ribonuclease D is not essential in E. coli and is deleterious when overexpressed. Its precise biological role is still unknown. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 130455
View PSSM: TIGR01388
Aligned: 7 rows
Threshold Bit Score: 489.281
Threshold Setting Gi: 499195734
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YT3_A         5 MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGI-TDWSPLKAILRDPSITKFLHAGS 83  Escherichia coli
AAG04683       8 WIRDDASLAQQCREWRTQPYLALDTEFMRVDTFYPAAGLVQVGDGRQEWLIDPLLI-QDWSPFAELLEDERVVKVLHACS 86  Pseudomonas aer...
P09155         5 MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGI-TDWSPLKAILRDPSITKFLHAGS 83  Escherichia col...
WP_000069193  13 IISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL-DEMTPFVELLQDTSVLKVLHACG 91  Vibrio cholerae
WP_010915555   3 VITTQKELETVLAAFEKSDFVTVDTEFIRETTFWPILCLIQMAAPGVTALIDPLSPdINLAPFFRLMANEAVVKVFHAAR 82  Mesorhizobium loti
WP_010919573   3 LITTTAELAAFCNGLAGEPFVAVDTEFMRETTYWPKLCLIQVASPTQEAVIDPLADnIDLEPLLVVMRDERILKVFHAAR 82  Caulobacter vib...
WP_010893274   4 WIQHPDTLATWWDRKPTR--IGMDTEFIRERTFWPELALVQIAIEDEILLVDPLVP-GMTDALGLWLAAPNVIKIMHSAS 80  Xylella fastidiosa
1YT3_A        84 EDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPIT 163 Escherichia coli
AAG04683      87 EDLEVFLRLTGSLPVPLFDTQLAAAYLGMAHSMGYSKLVKEVLDIDLPKDETRSDWLQRPLTEMQMRYAADDVQHLAQVY 166 Pseudomonas aer...
P09155        84 EDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPIT 163 Escherichia col...
WP_000069193  92 EDLEVFQNAFGCTPFPMVDTQIMAAFLGYGLSTGFAALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMY 171 Vibrio cholerae
WP_010915555  83 QDIEIIVHLGDLVPHPVFDTQVAAMVCGFGDSVSYDQLVQRITGARLDKSSRFTDWRHRPLSDKQLDYALADVTHLIEVY 162 Mesorhizobium loti
WP_010919573  83 QDVEIFNNL-KAMPKPLFDTQVAGMAAGFGEQIAYDALVRQMLRIEIDKSSRFTDWARRPLTDAQLSYALADVTHLAKLF 161 Caulobacter vib...
WP_010893274  81 EDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQKLVATVTNVALEKGETRSDWMHRPLTPAQLDYAANDVRYLFALH 160 Xylella fastidiosa
1YT3_A       164 AKLMVETEASGWLPAALDECRLMQMRrQEVVAPEDAWRDITNAWQLRTRQLACLQLLADWRLRKARERDLAVNFVVREEH 243 Escherichia coli
AAG04683     167 LALDTRLSEEKRAWLLEDGAELVANL-CRESDPREAYREVKLGWRLRPQQLAVLRELCAWREEQARLRNRPRNHVLRERT 245 Pseudomonas aer...
P09155       164 AKLMVETEASGWLPAALDECRLMQMRrQEVVAPEDAWRDITNAWQLRTRQLACLQLLADWRLRKARERDLAVNFVVREEH 243 Escherichia col...
WP_000069193 172 EKLVEQVTQAGWWDAALQESELQVAKrTKVSNPELAYLDIKGAWQLKPKELAILKPLATWRYHEAVNRDLALNFVIKETD 251 Vibrio cholerae
WP_010915555 163 QHLSAELARENRAHWLNEEMDVLTSReTYDPHPEDAWKRLK-MRLRKPQELAIVQAVAAWREREARERDVPRGRVLKDDA 241 Mesorhizobium loti
WP_010919573 162 PILRERLETSGRLAWVEEEMTAISDPaAYDVDPEKAWRRLR-PRKTAPKYLAVFKAVAAWRERTAQNRDQPRGRILKDEA 240 Caulobacter vib...
WP_010893274 161 DTLTERLAEMSRSAWLEEDCTRLTDNiEQNENERWPHLAIHSAQLLDAPAQYRLLRLLRWRETSARTRNKPRNWILNNEL 240 Xylella fastidiosa
1YT3_A       244 LWSVARYMPGSLGELDSL--G--LSGSEIRFHGKTLLALVEKAQTLPEDALPQPMLNLMDmP-GYRKAFKAIKSLITDVS 318 Escherichia coli
AAG04683     246 LWPLARLLPKNKTDLAAI--Ed-MHPRTVRQDGDFLIELIAQAARLPQSEWPEALPEPLP-P-EVTPLLKSLRAIGQREA 320 Pseudomonas aer...
P09155       244 LWSVARYMPGSLGELDSL--G--LSGSEIRFHGKTLLALVEKAQTLPEDALPQPMLNLMDmP-GYRKAFKAIKSLITDVS 318 Escherichia col...
WP_000069193 252 LLTISRLALRSPKRMEEE--G--VDPHAIRRHSSKIIAMVKTALETPADAYPPEIVPIMEyP-GYKQLFKRLKDEVKSVS 326 Vibrio cholerae
WP_010915555 242 IYEVAQQAPRDAAALAKLrtT--PKGWERSSTATALLGAVNTALALPKEQMPKLPKNFQPpE-GSSAAAELLKVLLRIVA 318 Mesorhizobium loti
WP_010919573 241 IDELATQTPGNLEALNNL--RgvPKGFGGSKFGPDLLAAIKDALADPEGYAPVVDKPGPPpPqNAGAVVELLKVLLKARA 318 Caulobacter vib...
WP_010893274 241 ASILARFPPPNLTELR-------YQLKKFNKSWDPLATQILEALHTPVADEAQAPLATAPsD-ADKALLKQLQKIVAECS 312 Xylella fastidiosa
1YT3_A       319 ETHKISAELLASRRQINQLLNWHWKlkp-qnNLPELISGWRGE-LMAEALHNLLQE 372 Escherichia coli
AAG04683     321 ETLGMAPELMLRKKVLEALLKSGYPdg--pyELPDSLRGWRRErMGQALLDALESA 374 Pseudomonas aeruginosa PAO1
P09155       319 ETHKISAELLASRRQINQLLNWHWKlkp-qnNLPELISGWRGE-LMAEALHNLLQE 372 Escherichia coli K-12
WP_000069193 327 NTSGLATEFLASKKQLNQLLSWVWKrdrdpaRLPDLMQGWRLP-LLGEKLNTLVLK 381 Vibrio cholerae
WP_010915555 319 EKQGVASKVLASSDDIDRIAAEGED------ADVPALQGWRRAvFGEAALKLVRGE 368 Mesorhizobium loti
WP_010919573 319 EEAGVASKLIATVSDLEKIAAD-DN------ATTPALTGWRREaFGSDALKIKRGE 367 Caulobacter vibrioides
WP_010893274 313 YDLGLPEGILASRRHLEALIEQRR--------WPNSLGQWRRS-LLETQLQPLLSM 359 Xylella fastidiosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap