Conserved Protein Domain Family
cztR_silR_copR

?
TIGR01387: cztR_silR_copR 
heavy metal response regulator
Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130454
View PSSM: TIGR01387
Aligned: 4 rows
Threshold Bit Score: 374.906
Threshold Setting Gi: 485771377
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q47456         4 ILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDGWQIISALReSGHEEPVLFLTAKD 83  Escherichia coli
Q44006         3 VLVVEDEPRTAEYLQKGLSESGFVVDIANNGGDGLHMAEETDYDVIILDVMLPGMDGWTVIKSIR-SKSETPVLFLTALD 81  Cupriavidus met...
AAG09631       3 ILVVEDEQKTADYLQQGLSESGYVVDCASNGIDGLHLAGQHAYELVILDVNLPGKDGWEVLEQLRrNGTQR-VMMLTARG 81  Pseudomonas flu...
WP_001395354   3 ILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLR-TAKQTPVICLTARD 81  Escherichia coli
Q47456        84 NVRDKVKGLELGADDYLIKPFDFTELVARVRTLLRRARSQAAT-VCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELL 162 Escherichia coli
Q44006        82 DVADRVRGFELGADDYLVKPFAFAELLARIRRCLRQSTSKESE-RLRIADLDIDVLGRRVFRGTTRIELTNQEFSLLHLL 160 Cupriavidus met...
AAG09631      82 RLADKIKGLDMGADDYLVKPFEFPELLARVRTLLRRSEHIPQPeVFSVQDLELDPRRHRAYRGSRRIDLTTKEFALLQVL 161 Pseudomonas flu...
WP_001395354  82 SVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNST--LEISGLRMDSVSHSVSRDNISITLTRKEFQLLWLL 159 Escherichia coli
Q47456       163 LQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVL 221 Escherichia coli
Q44006       161 MRRRGEVLSRTTIASQVWGVNFDTDTNVVDVAIRRLRSKVDDPFDQKLIHTVRGMGYVL 219 Cupriavidus metallidurans CH34
AAG09631     162 MRQTGEVLTRTQIISLVWDMNFDCDTNVVEVSISRLRAKVDDQSEVKLIHTIRGVGYVL 220 Pseudomonas fluorescens
WP_001395354 160 ASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSF 218 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap