Conserved Protein Domain Family
glut_syn

?
TIGR01380: glut_syn 
glutathione synthetase, prokaryotic
This model was built using glutathione synthetases found in Gram-negative bacteria. This gene does not appear to be present in genomes of Gram-positive bacteria. Glutathione synthetase has an ATP-binding domain in the COOH terminus and catalyzes the second step in the glutathione biosynthesis pathway: ATP + gamma-L-glutamyl-L-cysteine + glycine = ADP + phosphate + glutathione. Glutathione is a tripeptide that functions as a reductant in many cellular reactions. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 130447
View PSSM: TIGR01380
Aligned: 7 rows
Threshold Bit Score: 474.553
Threshold Setting Gi: 544429
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P35667         2 LKVAFQMD--EDVVVGRDVSVKLVEEAQRRGHEVFFYRPTSLAFVCGELVAEAFSVRVG------------ADSLHFHDK 67  Anaplasma centrale
O32463         1 MKLAFLIDpiAALDPTHDSTVALMEAAQLRGHEIWIGEISDLSVHVGEPLGLLRPLKIEpvqwlgdrwqvaNPWFTAGEA 80  Synechococcus e...
WP_010896158   7 LKIGILMDsiESINIKKDSSFAILLEAQKRNHIIHYMEMNDLYLRKEQAFARTRLIKLIkn---------tQKWYQFIKQ 77  Buchnera aphidi...
WP_010894415   3 LDVVVVMDpiTGIKIAKDTTFALLLEGQRRSHRLHYVHPGSLSLNEGRTFAQIAPLQVRdn---------kTDWYTLGEF 73  Xylella fastidiosa
WP_010872163   1 MKLAFIIDplEKLDPGHDSTVAIMEAAQKLGHEVFVTSVGDLAVINGQAWAKLAAVRLQpvilvdghwqvsQPWSELSKS 80  Synechocystis s...
WP_010981234   1 MKVLFIADpmASFKTYKDTTYAMMREMAKRGWRLFHTLSGELSVKNGLVVADASAFEFLgaqd-----dhdKNWFAAADK 75  Neisseria menin...
WP_010918030   3 LRVAVQMDpiLGINIDTDTSFLMMMEAQSRGHKLWFYTPDKLSQEDGRVFARAQPVEVFad---------kGAHARLGET 73  Caulobacter vib...
P35667        68 TRLPLGK-LDMLFVRQNPPFDMRYVTTTYLLERLD---ILMINNPKAIRDHPEKLLPLSFPKFIPPTLITESVSEISAFY 143 Anaplasma centrale
O32463        81 KRRSLHD-FAAVFMRKDPPVTTAYLYATYLLDLVDpkkTRVVNSPEGLRHANEKMYALQFQSVVPRTLVSSNKAEIRAFL 159 Synechococcus e...
WP_010896158  78 QSISLSE-LDVILMRKDPPFNTEFIYSTYILERAEetgVLIINKPKSLRDCNEKIFTSWFPDLITDTLVTRNIFQIRQFW 156 Buchnera aphidi...
WP_010894415  74 SETQLGQ-GQIILMRKDPPVNAEFIYDTQLLSIAQaagAQVINHPQGLRDLNEKLAAQLFPQCCPPTLISRDMRALKMFV 152 Xylella fastidiosa
WP_010872163  81 QWMALTE-CQAVFMRKDPPVTVQYLYATFILELLAptkTMVINSPQGLREANEKMYTLQFAAVMPPTVVSLDKGLIRQFL 159 Synechocystis s...
WP_010981234  76 VQTALKA-FDAVIMRTDPPFDMQYLYATQLLTLAEqqgAKVFNSGQAMRDFNEKLAILNFSRFTAPTLVTTRSADVRAFL 154 Neisseria menin...
WP_010918030  74 VMLDMKDdIDVVLMRQDPPFDMAYITATHFLEKVHp-hTLVVNNPAEVRNAPEKLFVTDFPGVQPPTLITSDHEAIYDFR 152 Caulobacter vib...
P35667       144 AEYGDIVLKPLYDYGGNGVCRICG-RADVGAISSAMVERYEAPLVAQQFIDDIS-SDKRVVLLGGRPIGaVRRKVTAMGE 221 Anaplasma centrale
O32463       160 DELRAAVLKPLGGKAGEGILFLDPgDRNFNSLVEISTQQGQLPVMVQQYLPEAKdGDKRIILVNGEPLG-AVNRVPTGRE 238 Synechococcus e...
WP_010896158 157 EKYQDIIIKPLDAMGGANIFRIKKnDPNFSVIVENMTNYERKYCMVQNYLPEIKlGDKRILIINGKPIPwCVARIARIGE 236 Buchnera aphidi...
WP_010894415 153 QKQEQAILKPLDGMGGHSIFRSSNgDPNLNVILETLTDGGRTLAIAQRYLQQIIeGDKRILLIDGVPIDhCLARIPQGDE 232 Xylella fastidiosa
WP_010872163 160 EEHGAAVLKPLGGKAGEGILFLDPgDRNFNSLVEISTQHGKEPVMVQRFLPEAKeGDKRIILLDGDPIG-AVNRIPSGAE 238 Synechocystis s...
WP_010981234 155 KEHGDIIIKPLDGMGGMGIFRLTEkDPNIGSILETLMQLDSRTIMAQRYIPEIVhGDKRILIIGGEVVPyALARIPQNGE 234 Neisseria menin...
WP_010918030 153 ARHGDIVLKPLYGGGGSGVARLLAdDPNLDALLELHAMIGREQVIAQKFVPAVSkGDKRVLLVDGEPVG-AINRVPASGQ 231 Caulobacter vib...
P35667       222 IRTNLRVGATPEATELSDREREICHDVGMLLSSVDILFAGIDILGGHLIEVNVTSPCGILEINQVYGKTLERDCWDYFEY 301 Anaplasma centrale
O32463       239 FRGNMAVGGRVEAVPITDRDREICAAVAPRLRQDGLFFVGIDVIGGYLTEVNVTSPTGIREIDRLNGVSIGDQTIAALEA 318 Synechococcus e...
WP_010896158 237 TRANLAAGGEGKIQSLSETDWKIANYLSPTLKKRGLILVGLDVIGDKLTEINVTSPTCICEIESQKNISITGMLLDYIEK 316 Buchnera aphidi...
WP_010894415 233 FRGNMAAGGRGESRPLNEHDRWIAAQVGPEMRRRGMRFVGIDVIGDYLTEINVTSPTCLRELDAQCGLNIAGQLFDAIET 312 Xylella fastidiosa
WP_010872163 239 FRGNMAVGGQVAPTTITSREIEICALLKPKLQADGLYFVGIDVIGGYLTEVNVTSPTGIREIDRLEGVRLGEKVICWLEK 318 Synechocystis s...
WP_010981234 235 TRGNLAAGGRGVAQELSERDREIAETLAPELKRRGILLAGLDVIGSNLTEVNVTSPTGFQEIMKQKGFDVAAMFADAVAE 314 Neisseria menin...
WP_010918030 232 VRSNLRVGGRAEAVELTARDLELCKIIAPELKRRGLLFVGIDVIGEYLTEINVTSPTGAQQLKRFTGVNAAEVLWNRIED 311 Caulobacter vib...
P35667       302 AL 303 Anaplasma centrale
O32463       319 LV 320 Synechococcus elongatus PCC 7942
WP_010896158 317 KV 318 Buchnera aphidicola
WP_010894415 313 GG 314 Xylella fastidiosa
WP_010872163 319 QF 320 Synechocystis sp. PCC 6803
WP_010981234 315 WS 316 Neisseria meningitidis
WP_010918030 312 IR 313 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap