1ZOV


Conserved Protein Domain Family
soxA_mon

?
TIGR01377: soxA_mon 
Click on image for an interactive view with Cn3D
sarcosine oxidase, monomeric form
Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130444
View PSSM: TIGR01377
Aligned: 5 rows
Threshold Bit Score: 626.472
Threshold Setting Gi: 4572673
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZOV_A           4 FDVIVVGAGSMGMAAGYYLAKQGVKTLLVDSFDPPHTNGSHHGDTRIIRHAYGEGrEYVPFALRAQELWYELEKETHHKI 83  Bacillus sp. ...
AAG49431         8 WDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLED-FYTRMMHECYQIWAQLEHEAGTQL 86  human
TIGR:At2g24580   9 FDVIVVGAGVMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPED-YYYSMVSESTRLWAAAQSEIGYKV 87  thale cress
P23342           5 FDVIVVGAGSMGMAAGYYLAKQGVKTLLVDSFDPPHTNGSHHGDTRIIRHAYGEGrEYVPFALRAQELWYELEKETHHKI 84  Bacillus sp. ...
AAC39948         8 WDAIVIGAGIQGCFTAYHLAKHSKSVLLLEQFFLPHSRGSSHGQSRIIRKAYPED-FYTMMMKECYQTWAQLEREAGTQL 86  house mouse
1ZOV_A          84 FTQTGVLVYGPKGGsAFVSETMEAANIHSLEHELFEGKQLTDRWA-GVEVPDNYEAIFEPNSGVLFSENCIQAYRELAEA 162 Bacillus sp. ...
AAG49431        87 HRQTGLLLLGMKEN-QELKTIQANLSRQRVEHQCLSSEELKQRFP-NIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQ 164 human
TIGR:At2g24580  88 HFPTQQFDMGPADQ-QSLLSVVATCQKHGLAHRVMDSHAVSEHFSgRISIPENWIGVSTELGGIIKPTKAVSMFQTLAIG 166 thale cress
P23342          85 FTQTGVLVYGPKGGsAFVSETMEAANIHSLEHELFEGKQLTDRWA-GVEVPDNYEAIFEPNSGVLFSENCIQAYRELAEA 163 Bacillus sp. ...
AAC39948        87 HRQTELLLLGTKEN-PGLKTIQATLSRQGIDHEYLSSVDLKQRFP-NIRFTRGEVGLLDKTGGVLYADKALRALQHIICH 164 house mouse
1ZOV_A         163 HGATVLTYTPVEDFEVt----EDLVTIKTAKGSYTANKLVVSMGAWNSKLLSKLD-VEIPLQPYRQVVGFFECDEAKYSN 237 Bacillus sp. ...
AAG49431       165 LGGIVRDGEKVVEINP-----GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLG-IEMPLQTLRINVCYWREMVPGSYG 238 human
TIGR:At2g24580 167 HGAILRDNTKVANIKRdgesgEGVIVCTVKGDKFYGKKCIVTAGAWIsKLVKTVAgIDFPVEPLETTVCYWRIKEGHEEK 246 thale cress
P23342         164 HGATVLTYTPVEDFEVt----EDLVTIKTAKGSYTANKLVVSMGAWNSKLLSKLD-VEIPLQPYRQVVGFFECDEAKYSN 238 Bacillus sp. ...
AAC39948       165 LGGTVCDGEKVVEIRP-----GLPVTVKTTLKSYQANSLVITAGPWTNRLLHPLG-IELPLQTLRINVCYWREKVPGSYG 238 house mouse
1ZOV_A         238 NA---HYPAFMVEVENG-IYYG-FPSFGGSGLKIGYHSYGQQIDPDTINREFG-AYPEDEANLRKFLEQYMPGAN--GEL 309 Bacillus sp. ...
AAG49431       239 VSq--AFPCFLWLGLCPhHIYG-LPTGEYPGLMKVSYHHGNHADPEERDCPTArTDIGDVQILSSFVRDHLPDLK--PEP 313 human
TIGR:At2g24580 247 FTidgEFPTFASYGAP--YVYG-TPSLEYPGLIKVAVHGGYWCDPDKRPWGPG----VKLEELKEWIKERFGGMVdsEGP 319 thale cress
P23342         239 NA---HYPAFMVEVENG--IYYgFPSFGGSGLKIGYHSYGQQIDPDTINREFG-AYPEDEANLRKFLEQYMPGAN--GEL 310 Bacillus sp. ...
AAC39948       239 VSq--AFPCILGLDLAPhHIYG-LPASEYPGLMKICYHHGDNVDPEERDCPKTfSDIQDVQILCHFVRDHLPGLR--AEP 313 house mouse
1ZOV_A         310 KKGAVCMYTKTPDEHFVIDLHP-KY-SNVAIAAGFSGHGFKFSSVVGETLAQLATTGKT---EHDISIFSLNRDALKKEA 384 Bacillus sp. ...
AAG49431       314 AVIESCMYTNTPDEQFILDRHP-KY-DNIVIGAGFSGHGFKLAPVVGKILYELSMKLTP---SYDLAAFSNQPFPKPGQS 388 human
TIGR:At2g24580 320 VATQLCMYSMTPDEDFVIDFLGgEFgRDVVVGGGFSGHGFKMAPAVGRILADMAMEVEAgggGVEMKQFSLRRFEDNPKG 399 thale cress
P23342         311 KKGAVCMYTKTPDEHFVIDLHP--KySNVAIAAGFSGHGFKFSSVVGETLAQLATTGKT---EHDISIFSLNRDALKKEA 385 Bacillus sp. ...
AAC39948       314 DIMERCMYTNTPDEHFILDWHP-KY-DNIVIGAGFSGHGFTLAPVVGKILYELSMKLPP---SYDLAPFRMSRFSTLSKA 388 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap