1VRQ


Conserved Protein Domain Family
soxD

?
TIGR01374: soxD 
Click on image for an interactive view with Cn3D
sarcosine oxidase, delta subunit family, heterotetrameric form
This model describes the delta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130441
View PSSM: TIGR01374
Aligned: 9 rows
Threshold Bit Score: 132.542
Threshold Setting Gi: 499217207
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VRQ_D         3 LIECPNCG-P-RNENEFKYGGEAHVAYPeDPNALSDKEWSRYLFYRGNKKGIFAERWVHSGGCRKWFNALRDTVSYEFKA 80  Corynebacterium...
CAC47433       3 LIYCPYCEeE-RSELEFRNAGDAHIVRPaNIAEISDEEFEEYFFLRQNPKGLIYERWRHIHGCGRFFNAARDTVSDRFHV 81  Sinorhizobium m...
AAK89128       3 LIRCPYCNeT-LPEAEFTYAGQAHIVRAaDPSSQSDEQWEEFLFIRDNVKGPHFERWRHLHGCGRFFNAVRDTVSDRFLT 81  Agrobacterium f...
O87387         4 LVPCPNCG-R-RPKEEFTIKG-AALSRP-E-ADADSIDWFDYVYLRENPRGAYEEYWHHTSGCRRWLVVARDTVTHEIAA 78  Sinorhizobium m...
WP_027026030   2 LITCPYCG-P-RDVIEFTYQGDGNRERP-DPASQNFEAWNAYVYDRLNPAGDHNEIWQHSGGCRAHLRVVRNTLTHEISS 78  Mesorhizobium s...
AAT49941       3 NIFCPHCG-ElRSEEEFHAKGQAHIPRPlDPNACSDEEWGDYMFFRDNPRGLHHELWVHAAGCRKYFNVTRHTVTYEILE 81  synthetic const...
WP_010913054   3 LFPCPFCG-P-RDETEFHYGGDAGNARP-DGAEVPIESWASYLYLRSNPKGTAREIWVHMS-CGEFFVMERDTVTHEVLS 78  Mesorhizobium loti
Q46336         3 LIECPNCG-P-RNETEFSYGGQAHVAYPeDPNALSDKEWSRYLFYRENSKGIFAERWVHSGGCRKWFNALRDTATYEFKA 80  Corynebacterium...
WP_010914747   2 rIVCPFCG-E-RELGEFTYLGDAKPVRP-A-ADAGEEAVYDYVYLRDNVAGVMSENWYHGGGCRAWLKVTRNTLTHEISA 77  Mesorhizobium loti
1VRQ_D        81 VYRAGE 86  Corynebacterium sp. U-96
CAC47433      82 TYKAGE 87  Sinorhizobium meliloti 1021
AAK89128      82 TYRAGE 87  Agrobacterium fabrum str. C58
O87387        79 CCDAAG 84  Sinorhizobium meliloti 1021
WP_027026030  79 VAFVRG 84  Mesorhizobium sp. URHA0056
AAT49941      82 TYLIGE 87  synthetic construct
WP_010913054  79 STALGG 84  Mesorhizobium loti
Q46336        81 VYRAGE 86  Corynebacterium sp. P-1
WP_010914747  78 IEPaag 83  Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap